SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331701917|ref|YP_004398876.1| from Lactobacillus buchneri NRRL B-30929

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331701917|ref|YP_004398876.1|
Domain Number 1 Region: 14-232
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.05e-51
Family PP-loop ATPase 0.00016
Further Details:      
 
Domain Number 2 Region: 374-443
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.0000000445
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|331701917|ref|YP_004398876.1|
Sequence length 460
Comment tRNA(Ile)-lysidine synthase [Lactobacillus buchneri NRRL B-30929]
Sequence
MDLQKQFNFIVKQKAWWQAGDAVVVAVSTGVDSMTLLYMLQHLPRAVRPKIIVAYVDHQL
RDQSVEETRYISNYCSEHGLLLKQAVWPKDDHPKVGIEAAARTFRYRFFERVLKETGSTC
LLTAHHGDDLVETVIMKLVRGGQLASLTGIRETRSFADANMIRPLLSFSKQQLESFAQTT
GIRWFEDETNQQLAVERNRIRHGVMPLLKAENPQLLPHVLSYTNQLADNLAAIEFLIQPL
IHSAVGFPEKQRAEIDLDSLKDFPDSVVKCLLEEVFEHYLRIPNVSVDQLDEVLGLIQQT
ARPQAKMDLEAGWQVRRVYQSLIICKEPQKIVGKPEKDRTFMVILDRWYSLSPSTKFGVF
TAHKTVANSKLTTFYLQDTDLPLQVRSPKAGDRLSIGHGQHQKVSRVLINAKVPNDQRER
TLLLVDARGTVLSVLGLKNAVVSRDSEDTRPYFLIEVRQK
Download sequence
Identical sequences A0A0R1JLG4 F4FRY7
WP_013728344.1.33153 WP_013728344.1.68932 gi|331701917|ref|YP_004398876.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]