SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|331702497|ref|YP_004399456.1| from Lactobacillus buchneri NRRL B-30929

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|331702497|ref|YP_004399456.1|
Domain Number 1 Region: 222-360
Classification Level Classification E-value
Superfamily CBS-domain pair 3.79e-29
Family CBS-domain pair 0.0013
Further Details:      
 
Domain Number 2 Region: 366-446
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 0.00000000000000464
Family CorC/HlyC domain-like 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|331702497|ref|YP_004399456.1|
Sequence length 462
Comment hypothetical protein Lbuc_2150 [Lactobacillus buchneri NRRL B-30929]
Sequence
MDDSQILTNLIIVIVTFLFAAFFVASEFALVQTRASALEERKKNLEEAKGNKAKGLKKLD
REIHMVTNLNEYLSTTQVGVSLAGIILGYLGESFVVTILVDVMEIHNSPIDPTAAHAVGA
VLGIIILTYLEVVLTEIVPKNISIDMPMQVLSFISTPLHYFHVIFYPFVWLLNISANGIV
KMLGLKVANENDESFSQAEILNLSRNAVKSGALEQNDYLYMQRAFQLNDKVAKDIMIDRT
QLVVIDITTTVKEAVQVYLQQKFSRIPVVANGDKDKILGYVYNYDLIRQSQVDPTIKIDR
LLRDISTTPEMTPITDVLHQMIQKRTPIVVVVDEYGGTSGIITDKDIYEELFGTVRDEID
PSITDYIFKQPNGTYQVNGKLTTHDFERYFDADFPEFTNSDAVTLAGYFLDNYPDIKAGD
VISFENFDFKIVDYENSFINWFEVTKHKVVPKPDDDDDHHDN
Download sequence
Identical sequences F4FV31
WP_013728921.1.33153 WP_013728921.1.68932 gi|331702497|ref|YP_004399456.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]