SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|407689314|ref|YP_006804487.1| from Alteromonas macleodii str. 'Balearic Sea AD45'

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|407689314|ref|YP_006804487.1|
Domain Number 1 Region: 18-523
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.52e-101
Family Pyridoxal-dependent decarboxylase 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|407689314|ref|YP_006804487.1|
Sequence length 544
Comment glutamate decarboxylase [Alteromonas macleodii str. 'Balearic Sea AD45']
Sequence
MGEAQVSLEHLFRVFTKPEHKDSKLAQIEQHLSDNILDFLSQHVVTKKTSLEEIEKDFSD
SKVPESPEFVSTHAESLLDKLVAHSVNTYSPTFIGHMTSALPYFHLPLSKLMVGLNQNLV
KIETSKAFTPLERQVLGMMHNLVYDQPQSFYDNHLHSAAHSLGAFCSGGTIANITALWVA
RNKLLGPQKGFSGVAKAGLAAAYRHYDINNLGVMCSKRGHYSLSKAVDVLGLGREQLLTV
PAPKQTLDPAKALRIGKRYQEEGNKLLAIVGVGGTTETGHVDPLDELADVAKELGCWFHV
DAAWGGATLFSARYRDRLKGIERADSVTIDAHKQMYVPMGAGMALFKDPQNANAVRHHAQ
YILRAGSKDLGATTLEGSRNGMAMMVYSALHIFGRKGYELLIDRSIDKAKDFAQMIDKAQ
DFELTTTPILSLLTYRVCPAEVQEKLKHVNAKTRNAINEKVDALVVAVQKQQREAGKSFV
SRTRLEAPDYPSQCITVFRVVLANPLTSHNDLAAILAEQHLIAKETQAWKELMDFVRETE
TVAS
Download sequence
Identical sequences A0A0E0YG51 A0A126Q3Q5 A0A2E8ML28 K0EIW2
gi|407689314|ref|YP_006804487.1| WP_014977595.1.19844 WP_014977595.1.2564 WP_014977595.1.28082 WP_014977595.1.29778 WP_014977595.1.31699 WP_014977595.1.31748 WP_014977595.1.65302 WP_014977595.1.81038 WP_014977595.1.85883 WP_014977595.1.96346 gi|407685377|ref|YP_006800551.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]