SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|392982029|ref|YP_006480616.1| from Pseudomonas aeruginosa DK2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|392982029|ref|YP_006480616.1|
Domain Number - Region: 47-94
Classification Level Classification E-value
Superfamily FlgN-like 0.0785
Family FlgN-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|392982029|ref|YP_006480616.1|
Sequence length 120
Comment hypothetical protein PADK2_03105 [Pseudomonas aeruginosa DK2]
Sequence
MSRLALLLPAVLLVLLAGALLGGGLVARHYRPQLEEALGQLTASRVASGQLEALLDEQQR
ALAAVRASAETRAKDVEQALGEARAQAAEQYAAAVRLLQEPDIGVDCQAAGAAIDRELGL
Download sequence
Identical sequences gi|392982029|ref|YP_006480616.1| gi|478476836|ref|YP_007707487.1| WP_003117967.1.101739 WP_003117967.1.10435 WP_003117967.1.12547 WP_003117967.1.14981 WP_003117967.1.18349 WP_003117967.1.21469 WP_003117967.1.22442 WP_003117967.1.24234 WP_003117967.1.2477 WP_003117967.1.29958 WP_003117967.1.31103 WP_003117967.1.32998 WP_003117967.1.33669 WP_003117967.1.36148 WP_003117967.1.37319 WP_003117967.1.43603 WP_003117967.1.45306 WP_003117967.1.50989 WP_003117967.1.51847 WP_003117967.1.53371 WP_003117967.1.53528 WP_003117967.1.57853 WP_003117967.1.58228 WP_003117967.1.60600 WP_003117967.1.61269 WP_003117967.1.62410 WP_003117967.1.69209 WP_003117967.1.71234 WP_003117967.1.71866 WP_003117967.1.72477 WP_003117967.1.78693 WP_003117967.1.78954 WP_003117967.1.79986 WP_003117967.1.80572 WP_003117967.1.83673 WP_003117967.1.86822 WP_003117967.1.87104 WP_003117967.1.87163 WP_003117967.1.91860 WP_003117967.1.92589 WP_003117967.1.92759 WP_003117967.1.96434 WP_003117967.1.97377 WP_003117967.1.97583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]