SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|319777414|ref|YP_004137065.1| from Mycoplasma fermentans M64

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|319777414|ref|YP_004137065.1|
Domain Number 1 Region: 2-55
Classification Level Classification E-value
Superfamily PTS system IIB component-like 0.0000000000214
Family PTS system, Fructose specific IIB subunit-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|319777414|ref|YP_004137065.1|
Sequence length 461
Comment PTS system, fructose-specific enzyme ii, bc component [Mycoplasma fermentans M64]
Sequence
MTNEDIQKAYGVIVAADTNIEITRFNGKRLLQTTVTKGIKQPKELIQEIIDEKVAVYKSD
SSSNENTNQEKLSFGKQIYKNLMNGVSHMLPFVIGGGILIALAFLFDSFLGKEAVGKDFG
QYTPFSKFFKNAGGFAFGFMMSVFAGFIAHSIAGRPGLAVGMVAGAMASSTQFAVYETGS
NAGFLGALIGGFIAGFLVLGLKWCFKWLPKSLDGLKPMLIYPVFGILLIAVIMFFVINTP
LSYLNYYIQQGLNYVVKNNTISIGFKIGMGALLAGMMAVDMGGPVNKVAYTIGVASVDPD
GINQPWIMAAVMIGGMVPPLVIAIAADLFPQKFTAKERKDSKVNYLMGMAFITEGTIPYA
ASDPLRVIGSSIFASTLAGGMAAGLGCSIPAPHGGIFVFVVAQGWYWYLLALVVGAFAGA
FILGALRKKVDPSELGRWKGIPIGNGVYLKRKVKQAQKVEK
Download sequence
Identical sequences gi|319777414|ref|YP_004137065.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]