SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332284109|ref|YP_004416020.1| from Pusillimonas sp. T7-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332284109|ref|YP_004416020.1|
Domain Number 1 Region: 36-222
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.00000069
Family RecA protein-like (ATPase-domain) 0.072
Further Details:      
 
Domain Number 2 Region: 415-584
Classification Level Classification E-value
Superfamily TPR-like 0.00000159
Family Transcription factor MalT domain III 0.037
Further Details:      
 
Weak hits

Sequence:  gi|332284109|ref|YP_004416020.1|
Domain Number - Region: 530-697
Classification Level Classification E-value
Superfamily TPR-like 0.00279
Family Transcription factor MalT domain III 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332284109|ref|YP_004416020.1|
Sequence length 779
Comment transcriptional regulator [Pusillimonas sp. T7-7]
Sequence
MLDAFGGAVYYVDLASVTDASVVPSAIASVLGLKVQVQDPKPSILAFFGARRALLVLDNC
EHLIDEIATLAEWLYKSAPQTHLLATSRELLRVEGEHVHILPPLDVPPVSDGMTTSDAMA
FPAVQLFMDRVAASGVQETLTDEMAPLAVEICRKMDGIALAIEWAAGRVRSHGLCGTAEL
INSRFNLLWQGRRSAPPRHQTLQAMLDWSYNLLSESERRALYRLSVFVGPFQLAAAQRVA
ADAVFTEVEVAVAIASLIDKSLLSPSMLNGSSHLRLLDTTRTYASAKLAGSGEVNSVSRK
LAEYLIEQFNRSSDHENERRAADRDVMLVGNMRTALAWAFSEAGDGELGVLLAALAAPLF
LRLSLLDECHRWCQAALSQLGSQEDSETHLILQDALAISALFTRVDRDDLRNLIERGLNL
ARKFDDHERELGLLAGQHIVMSHLGCFGEAVEVSWRSLELARRVGSPAGIIMSEWMLGCA
YHLAGDQAGALCHTEEGFKQAAAHGEMNVDRLGFAHRTRALIILARALWLSGAADRAAEV
ARQAVEEAESDERPMSMLVALLYASTVFLWRGDLEESAALANRLTQHVGRYSFGTNAVFG
IALSGEVALLRGEFRTAANKFREALGTLRTEKRHNVTTTVNRSMSAALLECGEILEAEAM
ITAAMEGAEARHESFNMPELLRTRAQIGLVSGRLDPRATEVMLWHSIELASCQGALSLEL
RSAMALGELLASEERTEEAYSILAEVYHRFTEGYETRDLRKARQLIEAWRPTIPFAKST
Download sequence
Identical sequences F4GQN0
gi|332284109|ref|YP_004416020.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]