SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332284114|ref|YP_004416025.1| from Pusillimonas sp. T7-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332284114|ref|YP_004416025.1|
Domain Number 1 Region: 207-476
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.99e-20
Family Extended AAA-ATPase domain 0.079
Further Details:      
 
Domain Number 2 Region: 72-170
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 1.11e-16
Family PhoB-like 0.0053
Further Details:      
 
Domain Number 3 Region: 790-938
Classification Level Classification E-value
Superfamily TPR-like 0.000000186
Family Tetratricopeptide repeat (TPR) 0.054
Further Details:      
 
Domain Number 4 Region: 679-825
Classification Level Classification E-value
Superfamily TPR-like 0.000065
Family Tetratricopeptide repeat (TPR) 0.076
Further Details:      
 
Weak hits

Sequence:  gi|332284114|ref|YP_004416025.1|
Domain Number - Region: 916-1020
Classification Level Classification E-value
Superfamily TPR-like 0.0228
Family Tetratricopeptide repeat (TPR) 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332284114|ref|YP_004416025.1|
Sequence length 1053
Comment transcriptional regulator [Pusillimonas sp. T7-7]
Sequence
MAVDGLNYAIAITAVSLSRTWTSVDWTGLLFWKISAVNREVQAERRPRVLCGGAYSMENN
HLHPRPYVPEGGEVVEFGPFRLHVTGRLLQRHGVAVKLGSRSLDLLIALVERAGEVLSGR
ELIARAWAGLVVDEANLRVNISNLRKCLGEGKDGSRYVVNLPGRGYSFVAPVTRMRSESP
PRKTEAARFADPSSANQPLISASGHSLPERPIRLIGRDVSVRALVQMLTEHRFVSIVGPG
GMGKTTVAISVAHTMLNSFNGAVYYVDLASVTDASLVPATIASVLGLKMQGQDPKPSILA
FLGIRRALLVLDNCEHLIDETAAIAEWLYKSAPQTHLLTTSRELLRVEGEHVHILPPLDV
PPVTDGMTAAYAMAFPAVQLFMNRVAASGAHETLTDATALLAVDICRKMDGIALAIELAA
GRVRSHGLRGTAELINSRFNLLWHGRRTSPPRHQTLQAMLDWSYNLLSESERQVLYRLSI
FVAPFHLAAAQWIAADSVLTEDEVAAAIASLIDKSLLSPSISNGSGHLRLLDSTRTYASA
KLAESGELNAVSRKLAEYLIAQLSRRDENEWQTTDRDVMGSYNMLPALVWAFSETGEGER
VCNLRTALAWAFSEAGEGELGVRLAALAAPHLLELSLLEECHRWCQAALLQLGPHGGSAT
HLILLEALAISALLTRSNGDEVRNSIERALRLARTLNDHERELGLLAGLHIFMIEIGHSR
GAVEVSQRSIKLARRVDSPTGIVMSEWMLGCAYHLAGDQAGALRHIEEGFKQAAVHGVTK
VDMYGYGHRVRALIALARALWLSGAADRAAQVAHQAVEEAEQNKQPVNVFVAELLYASTV
FLWRGDIEESEALVSRLIQIVNRYSFSPNVASAIALSGEVALLQGESRTAANRLREALGI
LHGEGRLLLTTMLNRSMSEALLECGDILEAEERISAALKRAEAGHESFDRPELLRTRAQI
GIVSGRMDTRAAETMLRQSSELANSQGALSLELRSAMALGSLLVSEERTEEAHAILAEVY
GRFTEGFETRDLRIARQLIEAWRIAAWEERVSD
Download sequence
Identical sequences F4GQN5
WP_013741940.1.69223 gi|332284114|ref|YP_004416025.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]