SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332284485|ref|YP_004416396.1| from Pusillimonas sp. T7-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332284485|ref|YP_004416396.1|
Domain Number 1 Region: 31-190,329-507
Classification Level Classification E-value
Superfamily TPR-like 0.00000000895
Family BTAD-like 0.09
Further Details:      
 
Weak hits

Sequence:  gi|332284485|ref|YP_004416396.1|
Domain Number - Region: 547-583,612-786
Classification Level Classification E-value
Superfamily Porins 0.00194
Family Outer membrane protein transport protein 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332284485|ref|YP_004416396.1|
Sequence length 819
Comment outer membrane protein PgaA [Pusillimonas sp. T7-7]
Sequence
MNTPTFLQCISAVIAFTLSNAAWPAVSRQEYDALIIDARAGNHEPALVMLRQHAIDHPQD
LRAVYDHVLIASWANHSGEAVAAYEALQPAPNRPPANVLEAVARAYRDTQRWDPALAHYR
QGQRLFPAQIRFAVGEVKTLADAGRREIALMQGQALVEAHPANADARLALSYALRNAPSP
YPVLQETSKARNLAPEKAYVLREYLGSLEQAGLAHAALETAQQHPGLVNASRMRKLQADY
AAELSRLAAAPARQEDERHDIADRAIAEYDRLIPAWQALGDEAKADVQRLQIDRLQALAV
RGRSLDVVSSYEALLVQGVQIPPYALRHVAASYLALKQPEKARDLYKQVLTAELSQRGNS
AEHLSNQIGLYYALIENEEFDEAGRLLDAAQAEQPTWRHIKGVPRKVPNDLHMYSEQTGA
LGLFYEDDTPAAQQRLEEMVSNAPRNVGLRTALANVYRNRGWPRKAEKQLKVAEALEPRS
PELEAGQGMTALNLQEWEQAEILVHDLTARYPERLSTQNLEREWELHNKAELRIQAGGGI
ASDSPVTGSGDLSIETVLYSAPIKHNWRVFGGGGYATGDFEEGRGEHRWLRTGIEWRGRD
LTAELELSSHNYGFGTKPGARVSAAYDLNDQWQIGASMALRSADTPLRALSNGVYANDAG
VYARWRQSDHREWNLSLSTMHFSDGNNRLTAVLGGRERLYSAPSLKADLLVGVAASSNTH
EDAAYFNPKSDLEVLPSLRLTHTLYRRYDKILEHSLLIGAGLYAQQHYDTGAIGVVGYGM
TYHHNDALQVGATLTGVSRPYDGVRERELRFMLEMTFRF
Download sequence
Identical sequences F4GTI9
gi|332284485|ref|YP_004416396.1| WP_013742308.1.69223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]