SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332284593|ref|YP_004416504.1| from Pusillimonas sp. T7-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332284593|ref|YP_004416504.1|
Domain Number 1 Region: 86-183,321-389
Classification Level Classification E-value
Superfamily TPR-like 0.00000000446
Family Tetratricopeptide repeat (TPR) 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332284593|ref|YP_004416504.1|
Sequence length 511
Comment hypothetical protein PT7_1340 [Pusillimonas sp. T7-7]
Sequence
MRTWFWTLLVLAAAVGLALLLREHSGNVLIVAQPWRVELSLTLAVLLILASFVILYCLLR
VLAWIGVRPERFRSWRSQRSQKREHELLENGWINVLEGRYPDAEKDLSKLLTRSKSKSRK
VLAGLASARASQHMGEYGRRDEALTLARQNAQDNPRLSEATAIVAAEMYLDQNRPQDALV
LLQPLQDATTRYFHATRLLLRAHRQLRNHDRVFELTRLLSRRGVLEKSEAVQLIETSAAA
RLRAGGVEGFKSIWSDLKSDERALPDVALAAADIQTAQGNIDEASKILETGISARLDPRL
LNAYSQCPPEHVARRLSKAEDWLKTHPDDSALLAALGNLCLTGQLWGQGERYLLRSMKIR
SDMRIHALLGNLYDRLGRPNDAMTHWRLASGVAGVLPVLPSSRSLPAADTRGDPTLVDVE
RLPPEAQVLRDMQVPLAASAADFVNDDDFVSAGQPVAGPAGADSVAPATPAVQQPIDTQD
SYLDEYFDSAPIPGVDLSQTSDRPRHGSGHD
Download sequence
Identical sequences F4GUP8
WP_013742416.1.69223 gi|332284593|ref|YP_004416504.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]