SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332285249|ref|YP_004417160.1| from Pusillimonas sp. T7-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332285249|ref|YP_004417160.1|
Domain Number 1 Region: 277-411
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000696
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Weak hits

Sequence:  gi|332285249|ref|YP_004417160.1|
Domain Number - Region: 56-107
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.003
Family Reprolysin-like 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|332285249|ref|YP_004417160.1|
Sequence length 461
Comment hypothetical protein PT7_1996 [Pusillimonas sp. T7-7]
Sequence
MGSASAVELSPSLERTLGDAIMEQGRRDPTYIADPDVSQYLTDLGRRLAAHASGGASQRI
TIFGVRDPQINAFALPGGYIGVNSGLLVSAQTESELASVVAHEIGHVVQRHIARGMTQRS
QSGNVVIAALAAALLAALSGSGDLAMGVAAFGQAAAVDQQLGFSRQAEQEADRAGFEMMR
KAGFDPRGMVHMFERLGNASRLNEGSGGGYTSTHPLSIQRMSDIQNRVARLPGTSPQSSD
AFWYIRAKLRVLQARSSTPLRNALDKLRLDAKQKTGVEQSAAWYGLAYAAWQKKDLPGAR
QALAQAQQQGRSSPEIAGLAVALALDQGDKAQALSLSQSAWARWPDSQVVALARTETLQK
TGQDAQAVELLAQLTRKWPDVPRLHQLQAQSYERLGRHIEARRAMASYYELTGALPSAVA
QLEQARSMSKDFYVQSELDVQIRTLKDRLQSDRQLLERFKS
Download sequence
Identical sequences F4GPL6
WP_013743070.1.69223 gi|332285249|ref|YP_004417160.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]