SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|332285596|ref|YP_004417507.1| from Pusillimonas sp. T7-7

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332285596|ref|YP_004417507.1|
Domain Number 1 Region: 145-225
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000123
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 
Domain Number 2 Region: 431-648
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000021
Family RecA protein-like (ATPase-domain) 0.051
Further Details:      
 
Domain Number 3 Region: 910-941,1065-1147
Classification Level Classification E-value
Superfamily TPR-like 0.000000835
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 
Domain Number 4 Region: 14-86
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.000017
Family PhoB-like 0.012
Further Details:      
 
Weak hits

Sequence:  gi|332285596|ref|YP_004417507.1|
Domain Number - Region: 292-418
Classification Level Classification E-value
Superfamily Nucleotide cyclase 0.00432
Family Adenylyl and guanylyl cyclase catalytic domain 0.019
Further Details:      
 
Domain Number - Region: 776-863,904-939
Classification Level Classification E-value
Superfamily TPR-like 0.00948
Family Tetratricopeptide repeat (TPR) 0.076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332285596|ref|YP_004417507.1|
Sequence length 1167
Comment hypothetical protein PT7_2343 [Pusillimonas sp. T7-7]
Sequence
MHPSLTRPIQLRLLGEFDVAVNDISATRKISYTKPRLLLAILAVSQGKPLARSKLANMLW
PASQQDSRANLRHALFVLRRLFESVPDIWLPSRHTLALNPDAIMVDALAVTGGYTDLNYL
DRLDYDRGSLLEHMELPDSSTFTAWHNNWQARIERDMAECRERLIGQLMDQGEHDLAIRH
AKRWVQQHPGDESTHRHLIRLLRDTGNDEAALLALEHCRQMLREHHNQDVLSDQTLTLLN
RTSVLAVNATDSKPEPAHALVPSREYRPLAVLGVALMLDTLDVEQDNPLQGLQTAIDRIR
SRAEAAGAQIQPGLDGSLLIVFGFPTLAERPAHLCASLACALRESVLPDGICIGMGMHAD
VAMLHSSDPAQIARPLSQHAMKLAYLAEPNEVLLTASTRDRIVGQFAVHYETRYDHELYV
LDAQRDIRPVERMFGRMREFDTLVRLWARLPKAQIPTSMVVRGDPGVGKSLLISVMAEYV
RRTGGDVRMLYSEEGYESKPFHPVRSHFAAGPSSSAGIESTQNTRAGMMEALISALLQRS
SPDASLLIIWEDLHWADPSSIALVSALLKRKQSAPTLILMSARNEFETNESWNELQLMPL
DRRAMAELVIHRARSQRLTLSQRDQIVEQASGIPLFAEEIVRQVALGAEIGATPIILDLI
SARISALDPAARQLVQFAAVAGNIDDSLLAYAAQKLNITSRQIQALMTQLRQHGLVAEGM
PARFCHDLTRVAVYQTMDPVQRKQQHANVAQFLIHRDVQQAQAQAVCIAQHLDASKHPDA
CHWWCVAGRDALTQSATSEAQTMADRALHALERISDERKRRKAEFECQLLRGSILTLLKG
GGAAETSRAYERVVELHRQDDDPDMQFQMQWGEWVVAFNTQIHAVALRLAENLLQHAEQR
DSDIVLGSAQYAIGQTRLFMGDAARAERWLRAALHTLGRRAVAGHHMTAWGTETAHSARG
MLAWVLALQGRDEEGMRIAQEGLAGRDESVQKPSRILCQAVLCELHRLRGDVESTQAAAQ
ALKSSTKDTSLVFWRALADGMMGWTAAHRGDQRGLHAIEHAVQVASRAMPVWQSPLELLL
ADSRNSLGQTELALECIERAGDLIEHYGTHLIRGAYLCQRGTAFAVTGRSDGAISCWQQA
IVESRRLGLSVYARRAEIQLKAHLHAA
Download sequence
Identical sequences F4GSF2
gi|332285596|ref|YP_004417507.1| WP_013743411.1.69223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]