SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325108348|ref|YP_004269416.1| from Planctomyces brasiliensis DSM 5305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325108348|ref|YP_004269416.1|
Domain Number 1 Region: 166-353
Classification Level Classification E-value
Superfamily Methylesterase CheB, C-terminal domain 1.7e-64
Family Methylesterase CheB, C-terminal domain 0.0000181
Further Details:      
 
Domain Number 2 Region: 4-112
Classification Level Classification E-value
Superfamily CheY-like 7.83e-29
Family CheY-related 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325108348|ref|YP_004269416.1|
Sequence length 364
Comment response regulator receiver modulated CheB methylesterase [Planctomyces brasiliensis DSM 5305]
Sequence
MNNQPIKVLIVDDSAVIRGLLAKALVRDAEIEVVGTAMHGDAALSWLKDRPADVVILDVE
MPVMDGLETLKQLREQHPEIRVIMASSLTSSGAKTSMIALSLGADACIAKPTAGSASEAM
QTVAGELIPLVKGLCGRGPARPSPPPPAVANTFLPTVRKKDSIAPPKLLVIGSSTGGPNA
LNRVLTDLGRDFKIPTLIVQHMPPMFTGMMARHLQSDVGRPVKEAEAGEKLQQGVTYVAP
GDFHMQLEENSDGMSLSLNQDPVEHYCRPSVNPLFRSAARLAGPRTLAVMLTGMGSDGFE
GTRDIVAQGGYVLAQDEASSVVWGMPGSIVNAGMAHEVLPLQEIGSRIINLCSTATSRAR
MECS
Download sequence
Identical sequences F0SG52
WP_013628121.1.67628 gi|325108348|ref|YP_004269416.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]