SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325108629|ref|YP_004269697.1| from Planctomyces brasiliensis DSM 5305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325108629|ref|YP_004269697.1|
Domain Number 1 Region: 85-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 6.94e-33
Family Ribosomal protein L6 0.0000502
Further Details:      
 
Domain Number 2 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal protein L6 7.2e-23
Family Ribosomal protein L6 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325108629|ref|YP_004269697.1|
Sequence length 181
Comment 50S ribosomal protein L6 [Planctomyces brasiliensis DSM 5305]
Sequence
MSRIGKKPVAILDKVEVSLNGRQVTVKGPVGSLEFTHHPLMTVKIDTDANQVVVERPDDS
RQCRALHGLTRAIINNMVQGVVTPYEKRLEVVGVGYQAQMRGKDLALQVGFANTITLPIP
EGVSCELPSATLIVLKSSDKHKVGQFAANIRSVRPPEPYKGKGIRYAGEHIRRKAGKAFA
K
Download sequence
Identical sequences F0SJA0
WP_013628400.1.67628 gi|325108629|ref|YP_004269697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]