SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325110084|ref|YP_004271152.1| from Planctomyces brasiliensis DSM 5305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325110084|ref|YP_004271152.1|
Domain Number 1 Region: 316-615
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 5.1e-89
Family DNA repair protein MutS, domain III 0.00000111
Further Details:      
 
Domain Number 2 Region: 617-863
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.59e-63
Family ABC transporter ATPase domain-like 0.000000742
Further Details:      
 
Domain Number 3 Region: 47-159
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain I 1.31e-42
Family DNA repair protein MutS, domain I 0.0000222
Further Details:      
 
Domain Number 4 Region: 158-315
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain II 1.09e-41
Family DNA repair protein MutS, domain II 0.0000919
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325110084|ref|YP_004271152.1|
Sequence length 925
Comment DNA mismatch repair protein MutS [Planctomyces brasiliensis DSM 5305]
Sequence
MDSQQPSVPDNSDHSAASTPETTSDERKTSPDKSAGKTKGKAGKSKSAPKLTPMMERFFE
VKRQHPDSLLLFRMGDFYELFYDDAVIAAKILGLTLTSRDKGSANPISMAGFPYHSLDNY
LQKLIRNGHRAAICDQVEDPKQAKGLVKREVTRIVTPGTLTEDALLDPRQNNYLAAVCLY
KKTAGLAWLELSTGRFQLAEVDPDNLSDELSRLHPAELLINQEQRDDERLASASLALPHM
LMTERPPWSFAGEQPYEQLCKHFRVRSLEGFDIEGPSTAVTAAGVLLEYVQETQRTAIDH
IRRIEPYSPEERLLIDEATRRSLELTHTLREGKRQGTLLDVIDETVTAMGARLIGEWISN
PLTNRQHITRRADAVEELVGNPLLLNEFREQLDNTYDLQRLATRVATGRCSPRDLTWLAK
TLSLLPATKKSLSQCQAARLHELHQLLDECEDVCADISSCLVEDPPINVADGDLVRAGYN
DRLDELRDLSRGGKEWIARYQAEEIERTGIQNLKVGFNKVFGYYLEVTAAQAQKVPEDYI
RKQTLKNQERFITPQLKEHEEKVLSADQQSLALETEIFQQLRERVADQLQRLQQSAETLA
ELDVLGSFAHTAANNDFCRPVLTESPVLRVVDGRHPVLDHILPRGQFVPNDIHLGQPEKA
EADEESTLPDAGRVQIITGPNMAGKSTYIRQAALVTLLAQAGSFVPAREATVGLVDRIFA
RVGASDELSKGQSTFMVEMTETARILNTATNRSLVILDEIGRGTSTYDGLSLAWAVTEYL
HDTIGARTLFATHYHELTELEQTLSAVRNWNVSVYEKDGDVIFLHKIVPGAADRSYGIHV
ARLAGVPTDVLRRAGEILSTLESDHVDETGKPTIPPRQTSPQRQLTLFEAPPHPVIEKLK
KLDLDALTPKAALDRLYELRGELQS
Download sequence
Identical sequences F0SP27
WP_013629849.1.67628 gi|325110084|ref|YP_004271152.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]