SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325106918|ref|YP_004267986.1| from Planctomyces brasiliensis DSM 5305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325106918|ref|YP_004267986.1|
Domain Number 1 Region: 390-574
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.44e-45
Family Pyruvate oxidase and decarboxylase PP module 0.0001
Further Details:      
 
Domain Number 2 Region: 197-364
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.89e-36
Family Pyruvate oxidase and decarboxylase, middle domain 0.0019
Further Details:      
 
Domain Number 3 Region: 36-211
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 5.61e-34
Family Pyruvate oxidase and decarboxylase Pyr module 0.0000594
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325106918|ref|YP_004267986.1|
Sequence length 577
Comment pyruvate decarboxylase [Planctomyces brasiliensis DSM 5305]
Sequence
MCAKSSSKSATAVSNGAASKPRKPAADRAAPPKRSARQSIGSYLIQRLQDYGIRDMFGIP
GDFVLQFYHQLEESPIRVIGTTREDCAGYAADGYARVNGMGAVCVTYCVGGLSLCNSIAG
AYAEKSAVVVISGAPGMEERRSDPLLHHKVRDFNTQREVFEKITVATASLDDPLTAFREI
DRCLEAAARYKRPVYLELPRDRVNSEPLYPYVTRNETNESNPEALEAAIVEAVERLAAAK
NPVIVAGVEIHRFGLRETLLKFAEKHKIPLSATLLGKSVVSEKHPLYLGVYEGAMGRDTV
RKYVEESDCVFLAGTFMTDINLGIFTAHLDPAKCIYATSEQLRIGYHHFHDVRLDDFLEG
LNKAKLKITAAKLPERKPIFEPFKAEADKPITTKRLFARLNEMLDENMVVVADVGDSLFG
ASDLTIYRHTEFLSPAYYTSMGFAIPAALGVQVADKNMRPIVLVGDGAFQMTCLELSTIL
RHSFNPIVIVLNNKGYTTERFLHEGPFNNILNWNYHRMPDLLGGGWGFEVETETELDQAL
NASLSNQDAFSLVNVHLDPMDISPALKRLAERMSKTI
Download sequence
Identical sequences F0SQI9
gi|325106918|ref|YP_004267986.1| WP_013626708.1.67628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]