SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325108896|ref|YP_004269964.1| from Planctomyces brasiliensis DSM 5305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325108896|ref|YP_004269964.1|
Domain Number 1 Region: 204-372
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.75e-63
Family Pyruvate oxidase and decarboxylase, middle domain 0.00000793
Further Details:      
 
Domain Number 2 Region: 381-592
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 2.16e-61
Family Pyruvate oxidase and decarboxylase PP module 0.000000726
Further Details:      
 
Domain Number 3 Region: 11-193
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 9.26e-56
Family Pyruvate oxidase and decarboxylase Pyr module 0.00000116
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|325108896|ref|YP_004269964.1|
Sequence length 594
Comment acetolactate synthase, large subunit [Planctomyces brasiliensis DSM 5305]
Sequence
MAIAEDTGTRQSTINGAEIMISALIQHQAKYVFAYPGGASMPLHQALRKYRDEIRTILPR
HEQGGAFAAQGVSRTTDSVGVCMATSGPGATNLVTSIADAKLDSVPLIAITGQVPQAVIG
SDAFQETPMVEVCRAITKHHYMITDIRDVARVVKEAFYVATTGRPGPVLIDFPKDVQLDS
IPVEELDLDPPMYLPGYHPELQDAAPEQVRQIIAAIRRSKKPVLYVGGGCILSGAAEELK
KFAEKTQIPVAMTVMGLGAFPGTHDLSLHMLGMHGTAYANMAVDESDLLLAFGVRFDDRV
TGKLEEFAKHGKIVHVDVDPSEIHKNKEAHIPVVADVKHILEELNKALTDDDVPDTKEWH
TQINGWKEKFPLKYADYSTEIPQQHAIQTLWKLTQEKNPYIAVGVGQHQMWTAQYFKFDK
PRHWLSSSGLGTMGFGLPAAMGVQTAHPNELVIDIDGDGSFQMNVQELATLVCEKLPVKI
LLLNNQHLGMVVQWEDRFMEGRRAHTYLGPVDHPEALGGGSGMPGEAIYPDFQTIAKGYG
IASQRVREKDKLEDAMREMIEHDGPYLLEVICPYQEHVLPMIPSGKTVREIITE
Download sequence
Identical sequences F0SM17
gi|325108896|ref|YP_004269964.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]