SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|325109406|ref|YP_004270474.1| from Planctomyces brasiliensis DSM 5305

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325109406|ref|YP_004270474.1|
Domain Number 1 Region: 244-507
Classification Level Classification E-value
Superfamily Thiamin diphosphate-binding fold (THDP-binding) 1.72e-61
Family Pyruvate oxidase and decarboxylase Pyr module 0.017
Further Details:      
 
Domain Number 2 Region: 25-237
Classification Level Classification E-value
Superfamily Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 8.11e-19
Family Pyruvate-ferredoxin oxidoreductase, PFOR, domain III 0.0057
Further Details:      
 
Domain Number 3 Region: 521-623
Classification Level Classification E-value
Superfamily TK C-terminal domain-like 4.4e-17
Family Branched-chain alpha-keto acid dehydrogenase beta-subunit, C-terminal-domain 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325109406|ref|YP_004270474.1|
Sequence length 626
Comment 2-oxoacid:acceptor oxidoreductase subunit alpha [Planctomyces brasiliensis DSM 5305]
Sequence
MSAVDVGTNGNGNFRTTEQVEAVVIRFCGDSGDGMQLVGTQFTNVSAIFGNDVSTLPDFP
AEIRAPAGTLGGVSGFQLCFSSNDIYTPGDEVDTLVAMNPAALKANLDDLKRGGTVILNE
DEFSEANLKKAGYAEDPLGDNDYLAGYRIHKVPMTRLTRDSVADLGLSLKEADRCKNFFA
LGLVFWLYDRNPQPTQDWIRNKFAKRPEIADANLAALKAGSDYGYSTQQFTVHYNVPPAK
LPPGKYRKITGNEAVAMGLVTAARLAEKDLFYSGYPITPASDILHELSKLKNYGVRTIQV
EDEIAAITATVGAAYGGAFAVTASSGPGIALKSEGIGLGVIMELPMVIVNVQRGGPSTGL
PTKTEQADLLMSLFGRNGECPMPIVAAATPGDAFYSAMEAMRLAVEFMTPVFLLSDGYIA
NGAEPWIVPKASELPRIKYKHAVEPNGDDGQFLPYRRDDRLVRPWAVPGTPGLEHRVGGL
EKWDDSGNVSYDPENHAHMIGTRARKVAGIADHIPEQAVEGPEEADLLVVSWGGTYGSVR
TAVLQAQRAGKSVAHAHIRYLSPFPRNLGDVLKRYKKVIVPELNCGQLRLLLRSQYLVDA
QGVNKIKGKPFLVSEIREAIEQALRQ
Download sequence
Identical sequences F0SFJ2
gi|325109406|ref|YP_004270474.1| WP_013629174.1.67628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]