SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386067388|ref|YP_005982692.1| from Pseudomonas aeruginosa NCGM2.S1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386067388|ref|YP_005982692.1|
Domain Number 1 Region: 6-130
Classification Level Classification E-value
Superfamily FlgN-like 3.01e-29
Family FlgN-like 0.000000398
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|386067388|ref|YP_005982692.1|
Sequence length 156
Comment hypothetical protein NCGM2_4483 [Pseudomonas aeruginosa NCGM2.S1]
Sequence
MPDSPTLLDLFAEDIGHASQLLQLVDEEFQALERRELPVLQQLLGAKQPLMQQLERNGRA
RAEILREAGVSLDREGLARYARERADGAELLARGDELGELLERCQQANLRNGRIIRANQA
STGSLLNILRGQDAPSLYDSRGGTASSSRQRPLSQA
Download sequence
Identical sequences A0A071KYA9 A0A0E1AV55 A0A0H2ZE48 A0A0H3RCI4 A0A157WB01 A0A1C7BNM6 A0A1E9CUV1 A0A1F0IHG3 A0A1G5F1E5 A0A1S1C705 V6ABX5 W1MHE7
gi|568308433|ref|YP_008980702.1| gi|478477796|ref|YP_007708447.1| 208963.PA14_20720 557722.PLES_17121 gi|386067388|ref|YP_005982692.1| WP_003091733.1.100071 WP_003091733.1.100100 WP_003091733.1.100278 WP_003091733.1.100420 WP_003091733.1.100469 WP_003091733.1.100476 WP_003091733.1.100523 WP_003091733.1.100654 WP_003091733.1.100742 WP_003091733.1.100786 WP_003091733.1.100808 WP_003091733.1.100810 WP_003091733.1.100872 WP_003091733.1.100983 WP_003091733.1.100995 WP_003091733.1.101090 WP_003091733.1.101269 WP_003091733.1.101340 WP_003091733.1.101506 WP_003091733.1.101572 WP_003091733.1.101590 WP_003091733.1.101712 WP_003091733.1.10174 WP_003091733.1.101781 WP_003091733.1.10179 WP_003091733.1.101809 WP_003091733.1.101819 WP_003091733.1.101863 WP_003091733.1.10201 WP_003091733.1.10204 WP_003091733.1.102045 WP_003091733.1.10248 WP_003091733.1.10257 WP_003091733.1.10271 WP_003091733.1.1037 WP_003091733.1.10419 WP_003091733.1.10435 WP_003091733.1.10457 WP_003091733.1.10468 WP_003091733.1.10477 WP_003091733.1.10482 WP_003091733.1.10513 WP_003091733.1.10529 WP_003091733.1.10548 WP_003091733.1.10572 WP_003091733.1.10575 WP_003091733.1.10636 WP_003091733.1.10641 WP_003091733.1.10684 WP_003091733.1.10764 WP_003091733.1.10895 WP_003091733.1.10901 WP_003091733.1.11026 WP_003091733.1.11058 WP_003091733.1.1107 WP_003091733.1.11077 WP_003091733.1.1109 WP_003091733.1.11130 WP_003091733.1.11178 WP_003091733.1.11318 WP_003091733.1.11381 WP_003091733.1.11410 WP_003091733.1.11454 WP_003091733.1.11568 WP_003091733.1.11569 WP_003091733.1.11653 WP_003091733.1.11744 WP_003091733.1.11754 WP_003091733.1.1180 WP_003091733.1.1183 WP_003091733.1.11847 WP_003091733.1.11854 WP_003091733.1.1187 WP_003091733.1.11943 WP_003091733.1.12018 WP_003091733.1.12081 WP_003091733.1.12120 WP_003091733.1.12150 WP_003091733.1.12200 WP_003091733.1.12208 WP_003091733.1.12240 WP_003091733.1.12302 WP_003091733.1.12400 WP_003091733.1.12482 WP_003091733.1.12497 WP_003091733.1.12547 WP_003091733.1.12561 WP_003091733.1.12660 WP_003091733.1.12670 WP_003091733.1.12687 WP_003091733.1.12744 WP_003091733.1.12797 WP_003091733.1.12838 WP_003091733.1.12873 WP_003091733.1.12890 WP_003091733.1.12922 WP_003091733.1.12930 WP_003091733.1.12934 WP_003091733.1.12970 WP_003091733.1.12980 WP_003091733.1.13 WP_003091733.1.13041 WP_003091733.1.1305 WP_003091733.1.13077 WP_003091733.1.13085 WP_003091733.1.13092 WP_003091733.1.13208 WP_003091733.1.13232 WP_003091733.1.13266 WP_003091733.1.13315 WP_003091733.1.13364 WP_003091733.1.13407 WP_003091733.1.13529 WP_003091733.1.13533 WP_003091733.1.1356 WP_003091733.1.1362 WP_003091733.1.13622 WP_003091733.1.13642 WP_003091733.1.13718 WP_003091733.1.13743 WP_003091733.1.13758 WP_003091733.1.13765 WP_003091733.1.13785 WP_003091733.1.13828 WP_003091733.1.1393 WP_003091733.1.14078 WP_003091733.1.14096 WP_003091733.1.14116 WP_003091733.1.14204 WP_003091733.1.14251 WP_003091733.1.14424 WP_003091733.1.14460 WP_003091733.1.14476 WP_003091733.1.14525 WP_003091733.1.14615 WP_003091733.1.14640 WP_003091733.1.14679 WP_003091733.1.14690 WP_003091733.1.14714 WP_003091733.1.1475 WP_003091733.1.14754 WP_003091733.1.14797 WP_003091733.1.14815 WP_003091733.1.14820 WP_003091733.1.14835 WP_003091733.1.14839 WP_003091733.1.14883 WP_003091733.1.14966 WP_003091733.1.15130 WP_003091733.1.1516 WP_003091733.1.152 WP_003091733.1.15222 WP_003091733.1.15281 WP_003091733.1.15328 WP_003091733.1.15373 WP_003091733.1.15379 WP_003091733.1.15408 WP_003091733.1.15474 WP_003091733.1.15480 WP_003091733.1.15482 WP_003091733.1.15485 WP_003091733.1.15602 WP_003091733.1.15606 WP_003091733.1.15666 WP_003091733.1.15692 WP_003091733.1.15889 WP_003091733.1.16041 WP_003091733.1.16109 WP_003091733.1.16161 WP_003091733.1.16197 WP_003091733.1.162 WP_003091733.1.16239 WP_003091733.1.16242 WP_003091733.1.16267 WP_003091733.1.16279 WP_003091733.1.16419 WP_003091733.1.1646 WP_003091733.1.1670 WP_003091733.1.1671 WP_003091733.1.16751 WP_003091733.1.16782 WP_003091733.1.16808 WP_003091733.1.16811 WP_003091733.1.16895 WP_003091733.1.17022 WP_003091733.1.1704 WP_003091733.1.17108 WP_003091733.1.17162 WP_003091733.1.17177 WP_003091733.1.17189 WP_003091733.1.172 WP_003091733.1.17223 WP_003091733.1.17353 WP_003091733.1.17354 WP_003091733.1.17370 WP_003091733.1.17499 WP_003091733.1.17566 WP_003091733.1.1758 WP_003091733.1.1761 WP_003091733.1.17697 WP_003091733.1.17883 WP_003091733.1.18052 WP_003091733.1.18054 WP_003091733.1.18117 WP_003091733.1.18156 WP_003091733.1.18157 WP_003091733.1.18199 WP_003091733.1.18204 WP_003091733.1.18234 WP_003091733.1.1824 WP_003091733.1.18349 WP_003091733.1.18440 WP_003091733.1.18493 WP_003091733.1.18508 WP_003091733.1.18728 WP_003091733.1.18732 WP_003091733.1.18769 WP_003091733.1.18795 WP_003091733.1.18852 WP_003091733.1.18892 WP_003091733.1.18907 WP_003091733.1.190 WP_003091733.1.19089 WP_003091733.1.19199 WP_003091733.1.19260 WP_003091733.1.19346 WP_003091733.1.19351 WP_003091733.1.19376 WP_003091733.1.19552 WP_003091733.1.19591 WP_003091733.1.19640 WP_003091733.1.19703 WP_003091733.1.1971 WP_003091733.1.19718 WP_003091733.1.19741 WP_003091733.1.19771 WP_003091733.1.19803 WP_003091733.1.19824 WP_003091733.1.19930 WP_003091733.1.19931 WP_003091733.1.20024 WP_003091733.1.20070 WP_003091733.1.2012 WP_003091733.1.20125 WP_003091733.1.20134 WP_003091733.1.20154 WP_003091733.1.20342 WP_003091733.1.20590 WP_003091733.1.20692 WP_003091733.1.20744 WP_003091733.1.20764 WP_003091733.1.20825 WP_003091733.1.20854 WP_003091733.1.20880 WP_003091733.1.20884 WP_003091733.1.20890 WP_003091733.1.209 WP_003091733.1.20929 WP_003091733.1.20978 WP_003091733.1.21002 WP_003091733.1.21039 WP_003091733.1.21096 WP_003091733.1.21209 WP_003091733.1.21242 WP_003091733.1.21253 WP_003091733.1.21302 WP_003091733.1.21349 WP_003091733.1.21448 WP_003091733.1.21469 WP_003091733.1.21517 WP_003091733.1.21607 WP_003091733.1.21718 WP_003091733.1.2172 WP_003091733.1.21744 WP_003091733.1.21767 WP_003091733.1.21782 WP_003091733.1.21801 WP_003091733.1.21863 WP_003091733.1.21932 WP_003091733.1.22078 WP_003091733.1.22316 WP_003091733.1.22324 WP_003091733.1.22365 WP_003091733.1.2237 WP_003091733.1.22390 WP_003091733.1.22442 WP_003091733.1.22491 WP_003091733.1.22704 WP_003091733.1.22729 WP_003091733.1.22863 WP_003091733.1.2289 WP_003091733.1.22891 WP_003091733.1.23166 WP_003091733.1.23191 WP_003091733.1.23195 WP_003091733.1.23264 WP_003091733.1.23331 WP_003091733.1.23394 WP_003091733.1.23418 WP_003091733.1.23421 WP_003091733.1.23523 WP_003091733.1.2355 WP_003091733.1.23559 WP_003091733.1.23581 WP_003091733.1.23611 WP_003091733.1.23641 WP_003091733.1.23715 WP_003091733.1.23739 WP_003091733.1.2374 WP_003091733.1.23769 WP_003091733.1.23782 WP_003091733.1.23794 WP_003091733.1.23884 WP_003091733.1.23925 WP_003091733.1.23938 WP_003091733.1.23961 WP_003091733.1.23967 WP_003091733.1.23983 WP_003091733.1.24066 WP_003091733.1.24077 WP_003091733.1.24101 WP_003091733.1.24183 WP_003091733.1.24234 WP_003091733.1.24319 WP_003091733.1.24351 WP_003091733.1.24382 WP_003091733.1.24413 WP_003091733.1.24447 WP_003091733.1.24626 WP_003091733.1.24662 WP_003091733.1.24851 WP_003091733.1.24862 WP_003091733.1.24869 WP_003091733.1.24940 WP_003091733.1.25033 WP_003091733.1.25052 WP_003091733.1.25067 WP_003091733.1.25075 WP_003091733.1.251 WP_003091733.1.25142 WP_003091733.1.25149 WP_003091733.1.25179 WP_003091733.1.25191 WP_003091733.1.2529 WP_003091733.1.2530 WP_003091733.1.25348 WP_003091733.1.25477 WP_003091733.1.25532 WP_003091733.1.25641 WP_003091733.1.25675 WP_003091733.1.25695 WP_003091733.1.2572 WP_003091733.1.25834 WP_003091733.1.26010 WP_003091733.1.26042 WP_003091733.1.261 WP_003091733.1.26159 WP_003091733.1.26301 WP_003091733.1.26334 WP_003091733.1.26473 WP_003091733.1.2652 WP_003091733.1.26539 WP_003091733.1.26553 WP_003091733.1.26592 WP_003091733.1.26604 WP_003091733.1.26681 WP_003091733.1.26705 WP_003091733.1.26740 WP_003091733.1.26862 WP_003091733.1.26906 WP_003091733.1.26967 WP_003091733.1.2698 WP_003091733.1.27018 WP_003091733.1.27039 WP_003091733.1.27073 WP_003091733.1.27218 WP_003091733.1.27288 WP_003091733.1.27505 WP_003091733.1.27534 WP_003091733.1.27549 WP_003091733.1.27587 WP_003091733.1.27687 WP_003091733.1.27738 WP_003091733.1.27772 WP_003091733.1.27783 WP_003091733.1.27825 WP_003091733.1.27837 WP_003091733.1.27933 WP_003091733.1.27939 WP_003091733.1.27966 WP_003091733.1.28006 WP_003091733.1.28057 WP_003091733.1.28078 WP_003091733.1.28136 WP_003091733.1.28175 WP_003091733.1.28193 WP_003091733.1.28258 WP_003091733.1.28316 WP_003091733.1.28329 WP_003091733.1.28372 WP_003091733.1.28382 WP_003091733.1.28383 WP_003091733.1.28404 WP_003091733.1.28468 WP_003091733.1.28505 WP_003091733.1.28528 WP_003091733.1.28560 WP_003091733.1.28623 WP_003091733.1.28699 WP_003091733.1.28713 WP_003091733.1.28757 WP_003091733.1.28800 WP_003091733.1.28823 WP_003091733.1.28838 WP_003091733.1.28849 WP_003091733.1.28878 WP_003091733.1.29003 WP_003091733.1.29008 WP_003091733.1.29062 WP_003091733.1.29070 WP_003091733.1.29096 WP_003091733.1.29127 WP_003091733.1.29179 WP_003091733.1.29208 WP_003091733.1.29401 WP_003091733.1.2941 WP_003091733.1.29438 WP_003091733.1.29440 WP_003091733.1.29472 WP_003091733.1.2948 WP_003091733.1.29481 WP_003091733.1.29498 WP_003091733.1.29501 WP_003091733.1.2961 WP_003091733.1.29633 WP_003091733.1.29650 WP_003091733.1.29753 WP_003091733.1.29767 WP_003091733.1.2980 WP_003091733.1.29848 WP_003091733.1.29920 WP_003091733.1.29958 WP_003091733.1.29973 WP_003091733.1.30000 WP_003091733.1.30020 WP_003091733.1.30081 WP_003091733.1.30120 WP_003091733.1.30254 WP_003091733.1.3030 WP_003091733.1.30365 WP_003091733.1.30475 WP_003091733.1.30563 WP_003091733.1.30567 WP_003091733.1.30614 WP_003091733.1.30615 WP_003091733.1.30693 WP_003091733.1.30707 WP_003091733.1.3072 WP_003091733.1.30842 WP_003091733.1.30886 WP_003091733.1.30943 WP_003091733.1.31045 WP_003091733.1.31076 WP_003091733.1.31087 WP_003091733.1.31103 WP_003091733.1.31105 WP_003091733.1.31138 WP_003091733.1.31147 WP_003091733.1.31279 WP_003091733.1.31457 WP_003091733.1.31501 WP_003091733.1.31563 WP_003091733.1.31565 WP_003091733.1.31587 WP_003091733.1.31633 WP_003091733.1.31655 WP_003091733.1.3172 WP_003091733.1.31732 WP_003091733.1.31741 WP_003091733.1.31751 WP_003091733.1.3179 WP_003091733.1.31852 WP_003091733.1.319 WP_003091733.1.31939 WP_003091733.1.32134 WP_003091733.1.32137 WP_003091733.1.32144 WP_003091733.1.32235 WP_003091733.1.32289 WP_003091733.1.32314 WP_003091733.1.32359 WP_003091733.1.32447 WP_003091733.1.32544 WP_003091733.1.32596 WP_003091733.1.32626 WP_003091733.1.32711 WP_003091733.1.32821 WP_003091733.1.32869 WP_003091733.1.32879 WP_003091733.1.33009 WP_003091733.1.33047 WP_003091733.1.33097 WP_003091733.1.33133 WP_003091733.1.33152 WP_003091733.1.33186 WP_003091733.1.33204 WP_003091733.1.33210 WP_003091733.1.33216 WP_003091733.1.33294 WP_003091733.1.33387 WP_003091733.1.33438 WP_003091733.1.33441 WP_003091733.1.3351 WP_003091733.1.33521 WP_003091733.1.33523 WP_003091733.1.33547 WP_003091733.1.33549 WP_003091733.1.33653 WP_003091733.1.33658 WP_003091733.1.33669 WP_003091733.1.3368 WP_003091733.1.33728 WP_003091733.1.33733 WP_003091733.1.33734 WP_003091733.1.3376 WP_003091733.1.33774 WP_003091733.1.33814 WP_003091733.1.33822 WP_003091733.1.33824 WP_003091733.1.33833 WP_003091733.1.3385 WP_003091733.1.33945 WP_003091733.1.34000 WP_003091733.1.34039 WP_003091733.1.34136 WP_003091733.1.34143 WP_003091733.1.34150 WP_003091733.1.34151 WP_003091733.1.34180 WP_003091733.1.34203 WP_003091733.1.34306 WP_003091733.1.34317 WP_003091733.1.3436 WP_003091733.1.34401 WP_003091733.1.34402 WP_003091733.1.34461 WP_003091733.1.34465 WP_003091733.1.34472 WP_003091733.1.3452 WP_003091733.1.34556 WP_003091733.1.34568 WP_003091733.1.34583 WP_003091733.1.34625 WP_003091733.1.34784 WP_003091733.1.34821 WP_003091733.1.34832 WP_003091733.1.34836 WP_003091733.1.34837 WP_003091733.1.34876 WP_003091733.1.34901 WP_003091733.1.35036 WP_003091733.1.35231 WP_003091733.1.35281 WP_003091733.1.35325 WP_003091733.1.35431 WP_003091733.1.35442 WP_003091733.1.35529 WP_003091733.1.3555 WP_003091733.1.35573 WP_003091733.1.35641 WP_003091733.1.35669 WP_003091733.1.35679 WP_003091733.1.35682 WP_003091733.1.3576 WP_003091733.1.35768 WP_003091733.1.35822 WP_003091733.1.35857 WP_003091733.1.35872 WP_003091733.1.35968 WP_003091733.1.36064 WP_003091733.1.36121 WP_003091733.1.36148 WP_003091733.1.36170 WP_003091733.1.36267 WP_003091733.1.36285 WP_003091733.1.36378 WP_003091733.1.36435 WP_003091733.1.36521 WP_003091733.1.3653 WP_003091733.1.36587 WP_003091733.1.36608 WP_003091733.1.36630 WP_003091733.1.36665 WP_003091733.1.36708 WP_003091733.1.3672 WP_003091733.1.36756 WP_003091733.1.36781 WP_003091733.1.36879 WP_003091733.1.37050 WP_003091733.1.37097 WP_003091733.1.37125 WP_003091733.1.37163 WP_003091733.1.37172 WP_003091733.1.37208 WP_003091733.1.3721 WP_003091733.1.373 WP_003091733.1.37319 WP_003091733.1.37366 WP_003091733.1.37416 WP_003091733.1.3742 WP_003091733.1.37500 WP_003091733.1.37512 WP_003091733.1.37571 WP_003091733.1.3768 WP_003091733.1.37698 WP_003091733.1.37703 WP_003091733.1.3773 WP_003091733.1.3781 WP_003091733.1.37814 WP_003091733.1.37818 WP_003091733.1.37826 WP_003091733.1.37842 WP_003091733.1.3792 WP_003091733.1.38003 WP_003091733.1.38023 WP_003091733.1.38060 WP_003091733.1.38087 WP_003091733.1.38146 WP_003091733.1.38151 WP_003091733.1.3818 WP_003091733.1.38186 WP_003091733.1.3821 WP_003091733.1.38319 WP_003091733.1.3833 WP_003091733.1.38335 WP_003091733.1.38430 WP_003091733.1.38450 WP_003091733.1.38502 WP_003091733.1.38510 WP_003091733.1.38582 WP_003091733.1.38583 WP_003091733.1.38587 WP_003091733.1.38657 WP_003091733.1.38661 WP_003091733.1.38816 WP_003091733.1.3887 WP_003091733.1.38889 WP_003091733.1.38932 WP_003091733.1.38971 WP_003091733.1.39046 WP_003091733.1.39088 WP_003091733.1.39122 WP_003091733.1.39186 WP_003091733.1.39271 WP_003091733.1.39326 WP_003091733.1.39345 WP_003091733.1.3943 WP_003091733.1.39444 WP_003091733.1.39452 WP_003091733.1.39537 WP_003091733.1.39704 WP_003091733.1.39765 WP_003091733.1.39786 WP_003091733.1.39811 WP_003091733.1.39920 WP_003091733.1.39949 WP_003091733.1.3998 WP_003091733.1.39989 WP_003091733.1.40059 WP_003091733.1.40115 WP_003091733.1.40135 WP_003091733.1.40207 WP_003091733.1.40213 WP_003091733.1.40237 WP_003091733.1.40243 WP_003091733.1.40271 WP_003091733.1.40419 WP_003091733.1.40442 WP_003091733.1.40512 WP_003091733.1.40541 WP_003091733.1.4058 WP_003091733.1.40874 WP_003091733.1.40950 WP_003091733.1.40984 WP_003091733.1.40993 WP_003091733.1.40994 WP_003091733.1.41110 WP_003091733.1.41137 WP_003091733.1.41199 WP_003091733.1.41290 WP_003091733.1.41291 WP_003091733.1.41301 WP_003091733.1.41384 WP_003091733.1.41429 WP_003091733.1.41502 WP_003091733.1.4156 WP_003091733.1.41618 WP_003091733.1.41625 WP_003091733.1.41703 WP_003091733.1.41725 WP_003091733.1.41732 WP_003091733.1.41748 WP_003091733.1.41832 WP_003091733.1.41888 WP_003091733.1.4190 WP_003091733.1.4196 WP_003091733.1.42 WP_003091733.1.42019 WP_003091733.1.42041 WP_003091733.1.42047 WP_003091733.1.42146 WP_003091733.1.42259 WP_003091733.1.42294 WP_003091733.1.42316 WP_003091733.1.42381 WP_003091733.1.42388 WP_003091733.1.42411 WP_003091733.1.42423 WP_003091733.1.42499 WP_003091733.1.42643 WP_003091733.1.42690 WP_003091733.1.42723 WP_003091733.1.4273 WP_003091733.1.42754 WP_003091733.1.42757 WP_003091733.1.42778 WP_003091733.1.42789 WP_003091733.1.42856 WP_003091733.1.42870 WP_003091733.1.42917 WP_003091733.1.42952 WP_003091733.1.42972 WP_003091733.1.42973 WP_003091733.1.43022 WP_003091733.1.43024 WP_003091733.1.43026 WP_003091733.1.43049 WP_003091733.1.43106 WP_003091733.1.43107 WP_003091733.1.43212 WP_003091733.1.43245 WP_003091733.1.43286 WP_003091733.1.43293 WP_003091733.1.43315 WP_003091733.1.43326 WP_003091733.1.43330 WP_003091733.1.4348 WP_003091733.1.43593 WP_003091733.1.43603 WP_003091733.1.43662 WP_003091733.1.43673 WP_003091733.1.43696 WP_003091733.1.43729 WP_003091733.1.43756 WP_003091733.1.43783 WP_003091733.1.43802 WP_003091733.1.43826 WP_003091733.1.4397 WP_003091733.1.43998 WP_003091733.1.44046 WP_003091733.1.44094 WP_003091733.1.44213 WP_003091733.1.44260 WP_003091733.1.44269 WP_003091733.1.44434 WP_003091733.1.44486 WP_003091733.1.44552 WP_003091733.1.44565 WP_003091733.1.44581 WP_003091733.1.44725 WP_003091733.1.44739 WP_003091733.1.44760 WP_003091733.1.44804 WP_003091733.1.44870 WP_003091733.1.4493 WP_003091733.1.45063 WP_003091733.1.45090 WP_003091733.1.45146 WP_003091733.1.45199 WP_003091733.1.45202 WP_003091733.1.4522 WP_003091733.1.45228 WP_003091733.1.45298 WP_003091733.1.45306 WP_003091733.1.45312 WP_003091733.1.4532 WP_003091733.1.45328 WP_003091733.1.45353 WP_003091733.1.45464 WP_003091733.1.45478 WP_003091733.1.45485 WP_003091733.1.45604 WP_003091733.1.45611 WP_003091733.1.45635 WP_003091733.1.45636 WP_003091733.1.45678 WP_003091733.1.45700 WP_003091733.1.45711 WP_003091733.1.45818 WP_003091733.1.45837 WP_003091733.1.45934 WP_003091733.1.45946 WP_003091733.1.46032 WP_003091733.1.46093 WP_003091733.1.461 WP_003091733.1.46152 WP_003091733.1.46200 WP_003091733.1.46306 WP_003091733.1.4640 WP_003091733.1.46436 WP_003091733.1.46502 WP_003091733.1.46623 WP_003091733.1.46633 WP_003091733.1.46755 WP_003091733.1.46787 WP_003091733.1.46826 WP_003091733.1.46866 WP_003091733.1.46926 WP_003091733.1.46935 WP_003091733.1.47101 WP_003091733.1.47158 WP_003091733.1.4726 WP_003091733.1.47296 WP_003091733.1.47312 WP_003091733.1.47314 WP_003091733.1.47469 WP_003091733.1.47480 WP_003091733.1.47527 WP_003091733.1.47551 WP_003091733.1.47645 WP_003091733.1.47774 WP_003091733.1.47934 WP_003091733.1.47970 WP_003091733.1.48001 WP_003091733.1.48024 WP_003091733.1.48086 WP_003091733.1.48094 WP_003091733.1.48141 WP_003091733.1.48172 WP_003091733.1.48178 WP_003091733.1.48321 WP_003091733.1.48334 WP_003091733.1.4836 WP_003091733.1.48378 WP_003091733.1.48472 WP_003091733.1.48474 WP_003091733.1.48487 WP_003091733.1.48545 WP_003091733.1.48579 WP_003091733.1.48747 WP_003091733.1.48810 WP_003091733.1.48820 WP_003091733.1.48840 WP_003091733.1.48842 WP_003091733.1.48851 WP_003091733.1.48961 WP_003091733.1.49108 WP_003091733.1.4913 WP_003091733.1.49135 WP_003091733.1.49184 WP_003091733.1.49244 WP_003091733.1.49265 WP_003091733.1.49266 WP_003091733.1.49286 WP_003091733.1.49360 WP_003091733.1.49416 WP_003091733.1.49557 WP_003091733.1.49566 WP_003091733.1.49688 WP_003091733.1.49798 WP_003091733.1.49806 WP_003091733.1.49833 WP_003091733.1.49842 WP_003091733.1.49922 WP_003091733.1.49948 WP_003091733.1.49976 WP_003091733.1.49998 WP_003091733.1.50176 WP_003091733.1.50180 WP_003091733.1.50222 WP_003091733.1.50232 WP_003091733.1.50242 WP_003091733.1.5043 WP_003091733.1.50450 WP_003091733.1.50459 WP_003091733.1.50567 WP_003091733.1.50665 WP_003091733.1.50668 WP_003091733.1.50682 WP_003091733.1.50691 WP_003091733.1.50734 WP_003091733.1.50783 WP_003091733.1.50922 WP_003091733.1.50967 WP_003091733.1.50989 WP_003091733.1.51019 WP_003091733.1.51136 WP_003091733.1.51173 WP_003091733.1.51183 WP_003091733.1.51267 WP_003091733.1.51457 WP_003091733.1.51472 WP_003091733.1.51501 WP_003091733.1.51538 WP_003091733.1.51549 WP_003091733.1.51585 WP_003091733.1.51727 WP_003091733.1.51733 WP_003091733.1.51807 WP_003091733.1.51847 WP_003091733.1.51889 WP_003091733.1.51917 WP_003091733.1.51928 WP_003091733.1.51937 WP_003091733.1.51943 WP_003091733.1.51957 WP_003091733.1.51976 WP_003091733.1.52212 WP_003091733.1.52220 WP_003091733.1.5226 WP_003091733.1.52326 WP_003091733.1.52334 WP_003091733.1.5235 WP_003091733.1.52355 WP_003091733.1.52372 WP_003091733.1.52403 WP_003091733.1.52409 WP_003091733.1.52449 WP_003091733.1.52500 WP_003091733.1.52537 WP_003091733.1.5258 WP_003091733.1.52583 WP_003091733.1.52591 WP_003091733.1.5260 WP_003091733.1.52690 WP_003091733.1.52697 WP_003091733.1.52700 WP_003091733.1.52784 WP_003091733.1.52790 WP_003091733.1.52850 WP_003091733.1.5289 WP_003091733.1.52939 WP_003091733.1.5294 WP_003091733.1.53038 WP_003091733.1.53070 WP_003091733.1.53072 WP_003091733.1.53169 WP_003091733.1.53267 WP_003091733.1.53287 WP_003091733.1.53351 WP_003091733.1.53371 WP_003091733.1.53414 WP_003091733.1.53427 WP_003091733.1.53486 WP_003091733.1.53528 WP_003091733.1.53530 WP_003091733.1.53586 WP_003091733.1.53678 WP_003091733.1.53726 WP_003091733.1.5388 WP_003091733.1.53932 WP_003091733.1.53946 WP_003091733.1.53948 WP_003091733.1.53951 WP_003091733.1.5399 WP_003091733.1.54003 WP_003091733.1.54076 WP_003091733.1.54090 WP_003091733.1.54133 WP_003091733.1.54140 WP_003091733.1.54146 WP_003091733.1.54248 WP_003091733.1.5427 WP_003091733.1.54293 WP_003091733.1.54354 WP_003091733.1.54462 WP_003091733.1.54571 WP_003091733.1.54742 WP_003091733.1.54809 WP_003091733.1.54974 WP_003091733.1.55 WP_003091733.1.55089 WP_003091733.1.55169 WP_003091733.1.55318 WP_003091733.1.55387 WP_003091733.1.55445 WP_003091733.1.55543 WP_003091733.1.55729 WP_003091733.1.55813 WP_003091733.1.55976 WP_003091733.1.56013 WP_003091733.1.56145 WP_003091733.1.56196 WP_003091733.1.56228 WP_003091733.1.56229 WP_003091733.1.56315 WP_003091733.1.56348 WP_003091733.1.56465 WP_003091733.1.56474 WP_003091733.1.56475 WP_003091733.1.56626 WP_003091733.1.56632 WP_003091733.1.56745 WP_003091733.1.56768 WP_003091733.1.56797 WP_003091733.1.56819 WP_003091733.1.56837 WP_003091733.1.56864 WP_003091733.1.56896 WP_003091733.1.56973 WP_003091733.1.57005 WP_003091733.1.57020 WP_003091733.1.57065 WP_003091733.1.57113 WP_003091733.1.57131 WP_003091733.1.57276 WP_003091733.1.5731 WP_003091733.1.57339 WP_003091733.1.57369 WP_003091733.1.57417 WP_003091733.1.57477 WP_003091733.1.57480 WP_003091733.1.57548 WP_003091733.1.57566 WP_003091733.1.57792 WP_003091733.1.57841 WP_003091733.1.57853 WP_003091733.1.57921 WP_003091733.1.57966 WP_003091733.1.58019 WP_003091733.1.58183 WP_003091733.1.58193 WP_003091733.1.58200 WP_003091733.1.58228 WP_003091733.1.58360 WP_003091733.1.58417 WP_003091733.1.58436 WP_003091733.1.5850 WP_003091733.1.58510 WP_003091733.1.58527 WP_003091733.1.5856 WP_003091733.1.58581 WP_003091733.1.5869 WP_003091733.1.58800 WP_003091733.1.5889 WP_003091733.1.58944 WP_003091733.1.58952 WP_003091733.1.5897 WP_003091733.1.59013 WP_003091733.1.59076 WP_003091733.1.59099 WP_003091733.1.59156 WP_003091733.1.59158 WP_003091733.1.59176 WP_003091733.1.59212 WP_003091733.1.59246 WP_003091733.1.59250 WP_003091733.1.59288 WP_003091733.1.59339 WP_003091733.1.59376 WP_003091733.1.59385 WP_003091733.1.59563 WP_003091733.1.59688 WP_003091733.1.59724 WP_003091733.1.59797 WP_003091733.1.59831 WP_003091733.1.59870 WP_003091733.1.59943 WP_003091733.1.60051 WP_003091733.1.60079 WP_003091733.1.60084 WP_003091733.1.60206 WP_003091733.1.60261 WP_003091733.1.60364 WP_003091733.1.60396 WP_003091733.1.60415 WP_003091733.1.60467 WP_003091733.1.60472 WP_003091733.1.60509 WP_003091733.1.60602 WP_003091733.1.60603 WP_003091733.1.60639 WP_003091733.1.60686 WP_003091733.1.607 WP_003091733.1.60850 WP_003091733.1.60910 WP_003091733.1.60916 WP_003091733.1.60970 WP_003091733.1.61130 WP_003091733.1.61209 WP_003091733.1.61222 WP_003091733.1.61269 WP_003091733.1.61288 WP_003091733.1.61294 WP_003091733.1.6130 WP_003091733.1.61493 WP_003091733.1.61549 WP_003091733.1.61589 WP_003091733.1.61598 WP_003091733.1.616 WP_003091733.1.61696 WP_003091733.1.6173 WP_003091733.1.62010 WP_003091733.1.62035 WP_003091733.1.62180 WP_003091733.1.62186 WP_003091733.1.62211 WP_003091733.1.62410 WP_003091733.1.6242 WP_003091733.1.62483 WP_003091733.1.62516 WP_003091733.1.62534 WP_003091733.1.626 WP_003091733.1.62604 WP_003091733.1.62635 WP_003091733.1.62688 WP_003091733.1.62701 WP_003091733.1.62703 WP_003091733.1.62704 WP_003091733.1.62708 WP_003091733.1.62716 WP_003091733.1.62768 WP_003091733.1.62772 WP_003091733.1.6280 WP_003091733.1.62834 WP_003091733.1.62838 WP_003091733.1.62873 WP_003091733.1.62961 WP_003091733.1.62977 WP_003091733.1.63041 WP_003091733.1.63057 WP_003091733.1.63193 WP_003091733.1.63196 WP_003091733.1.63338 WP_003091733.1.63401 WP_003091733.1.63591 WP_003091733.1.63597 WP_003091733.1.63634 WP_003091733.1.63739 WP_003091733.1.63784 WP_003091733.1.63929 WP_003091733.1.63941 WP_003091733.1.63995 WP_003091733.1.64155 WP_003091733.1.64198 WP_003091733.1.64212 WP_003091733.1.64309 WP_003091733.1.64329 WP_003091733.1.64340 WP_003091733.1.64433 WP_003091733.1.6450 WP_003091733.1.64544 WP_003091733.1.64591 WP_003091733.1.64605 WP_003091733.1.6461 WP_003091733.1.64611 WP_003091733.1.64726 WP_003091733.1.64748 WP_003091733.1.64799 WP_003091733.1.64807 WP_003091733.1.64854 WP_003091733.1.64862 WP_003091733.1.64880 WP_003091733.1.64885 WP_003091733.1.64886 WP_003091733.1.64983 WP_003091733.1.64984 WP_003091733.1.65092 WP_003091733.1.65095 WP_003091733.1.65099 WP_003091733.1.65145 WP_003091733.1.65196 WP_003091733.1.65227 WP_003091733.1.65237 WP_003091733.1.65285 WP_003091733.1.65312 WP_003091733.1.65316 WP_003091733.1.65334 WP_003091733.1.65335 WP_003091733.1.65457 WP_003091733.1.65478 WP_003091733.1.65549 WP_003091733.1.65632 WP_003091733.1.65642 WP_003091733.1.65679 WP_003091733.1.65740 WP_003091733.1.65779 WP_003091733.1.65819 WP_003091733.1.6589 WP_003091733.1.65926 WP_003091733.1.66088 WP_003091733.1.66155 WP_003091733.1.66165 WP_003091733.1.6627 WP_003091733.1.66277 WP_003091733.1.66348 WP_003091733.1.66364 WP_003091733.1.66526 WP_003091733.1.66563 WP_003091733.1.66634 WP_003091733.1.66693 WP_003091733.1.66892 WP_003091733.1.66929 WP_003091733.1.66931 WP_003091733.1.66950 WP_003091733.1.66982 WP_003091733.1.67124 WP_003091733.1.67188 WP_003091733.1.67192 WP_003091733.1.67205 WP_003091733.1.67261 WP_003091733.1.67370 WP_003091733.1.67388 WP_003091733.1.67472 WP_003091733.1.67489 WP_003091733.1.67506 WP_003091733.1.67526 WP_003091733.1.67545 WP_003091733.1.67686 WP_003091733.1.67755 WP_003091733.1.67830 WP_003091733.1.67874 WP_003091733.1.67875 WP_003091733.1.67899 WP_003091733.1.67903 WP_003091733.1.67937 WP_003091733.1.67948 WP_003091733.1.6796 WP_003091733.1.68000 WP_003091733.1.68158 WP_003091733.1.68162 WP_003091733.1.68172 WP_003091733.1.68183 WP_003091733.1.68194 WP_003091733.1.68252 WP_003091733.1.68317 WP_003091733.1.68446 WP_003091733.1.68448 WP_003091733.1.68472 WP_003091733.1.68499 WP_003091733.1.68638 WP_003091733.1.68756 WP_003091733.1.68781 WP_003091733.1.68790 WP_003091733.1.68800 WP_003091733.1.68802 WP_003091733.1.68850 WP_003091733.1.68862 WP_003091733.1.68881 WP_003091733.1.68938 WP_003091733.1.68979 WP_003091733.1.69088 WP_003091733.1.6911 WP_003091733.1.69159 WP_003091733.1.69260 WP_003091733.1.6928 WP_003091733.1.6937 WP_003091733.1.69411 WP_003091733.1.69534 WP_003091733.1.69556 WP_003091733.1.69599 WP_003091733.1.69702 WP_003091733.1.69788 WP_003091733.1.69819 WP_003091733.1.69834 WP_003091733.1.69907 WP_003091733.1.69993 WP_003091733.1.70092 WP_003091733.1.70138 WP_003091733.1.70168 WP_003091733.1.70194 WP_003091733.1.70216 WP_003091733.1.70229 WP_003091733.1.70331 WP_003091733.1.70460 WP_003091733.1.70470 WP_003091733.1.70537 WP_003091733.1.70561 WP_003091733.1.70583 WP_003091733.1.70648 WP_003091733.1.70650 WP_003091733.1.70670 WP_003091733.1.70677 WP_003091733.1.70693 WP_003091733.1.7077 WP_003091733.1.70778 WP_003091733.1.70991 WP_003091733.1.71038 WP_003091733.1.71141 WP_003091733.1.71203 WP_003091733.1.71249 WP_003091733.1.71254 WP_003091733.1.7128 WP_003091733.1.71290 WP_003091733.1.71346 WP_003091733.1.71385 WP_003091733.1.71412 WP_003091733.1.71570 WP_003091733.1.71610 WP_003091733.1.7163 WP_003091733.1.71642 WP_003091733.1.71666 WP_003091733.1.71738 WP_003091733.1.71799 WP_003091733.1.71806 WP_003091733.1.71822 WP_003091733.1.71862 WP_003091733.1.71891 WP_003091733.1.71934 WP_003091733.1.72149 WP_003091733.1.72167 WP_003091733.1.72181 WP_003091733.1.72183 WP_003091733.1.7219 WP_003091733.1.72287 WP_003091733.1.72323 WP_003091733.1.72331 WP_003091733.1.72346 WP_003091733.1.72541 WP_003091733.1.72562 WP_003091733.1.72570 WP_003091733.1.72653 WP_003091733.1.72662 WP_003091733.1.72727 WP_003091733.1.72768 WP_003091733.1.72772 WP_003091733.1.72782 WP_003091733.1.72845 WP_003091733.1.72920 WP_003091733.1.73035 WP_003091733.1.73048 WP_003091733.1.73135 WP_003091733.1.73149 WP_003091733.1.73192 WP_003091733.1.7327 WP_003091733.1.733 WP_003091733.1.73523 WP_003091733.1.73541 WP_003091733.1.73719 WP_003091733.1.73728 WP_003091733.1.7377 WP_003091733.1.7382 WP_003091733.1.73860 WP_003091733.1.73911 WP_003091733.1.73941 WP_003091733.1.74000 WP_003091733.1.74072 WP_003091733.1.74074 WP_003091733.1.74106 WP_003091733.1.74167 WP_003091733.1.74175 WP_003091733.1.74219 WP_003091733.1.74264 WP_003091733.1.74268 WP_003091733.1.74281 WP_003091733.1.74287 WP_003091733.1.74326 WP_003091733.1.7445 WP_003091733.1.74458 WP_003091733.1.74473 WP_003091733.1.74475 WP_003091733.1.7448 WP_003091733.1.74518 WP_003091733.1.74568 WP_003091733.1.74604 WP_003091733.1.74629 WP_003091733.1.74637 WP_003091733.1.74685 WP_003091733.1.748 WP_003091733.1.74878 WP_003091733.1.74941 WP_003091733.1.74948 WP_003091733.1.7501 WP_003091733.1.75041 WP_003091733.1.75204 WP_003091733.1.75303 WP_003091733.1.75389 WP_003091733.1.75431 WP_003091733.1.7547 WP_003091733.1.75549 WP_003091733.1.75573 WP_003091733.1.75580 WP_003091733.1.75599 WP_003091733.1.75603 WP_003091733.1.75631 WP_003091733.1.7568 WP_003091733.1.75756 WP_003091733.1.75771 WP_003091733.1.75792 WP_003091733.1.75826 WP_003091733.1.75935 WP_003091733.1.75938 WP_003091733.1.75947 WP_003091733.1.7595 WP_003091733.1.76077 WP_003091733.1.76092 WP_003091733.1.76141 WP_003091733.1.76145 WP_003091733.1.76355 WP_003091733.1.76399 WP_003091733.1.76441 WP_003091733.1.76467 WP_003091733.1.76484 WP_003091733.1.76600 WP_003091733.1.76633 WP_003091733.1.76716 WP_003091733.1.76775 WP_003091733.1.76791 WP_003091733.1.76861 WP_003091733.1.76985 WP_003091733.1.77235 WP_003091733.1.77286 WP_003091733.1.77317 WP_003091733.1.77442 WP_003091733.1.77476 WP_003091733.1.77490 WP_003091733.1.77566 WP_003091733.1.77574 WP_003091733.1.77587 WP_003091733.1.77686 WP_003091733.1.77750 WP_003091733.1.7779 WP_003091733.1.77819 WP_003091733.1.77834 WP_003091733.1.77913 WP_003091733.1.78104 WP_003091733.1.78112 WP_003091733.1.78118 WP_003091733.1.78148 WP_003091733.1.78158 WP_003091733.1.78280 WP_003091733.1.78288 WP_003091733.1.78380 WP_003091733.1.7840 WP_003091733.1.78409 WP_003091733.1.78425 WP_003091733.1.78430 WP_003091733.1.78437 WP_003091733.1.78570 WP_003091733.1.78599 WP_003091733.1.78623 WP_003091733.1.78795 WP_003091733.1.788 WP_003091733.1.78810 WP_003091733.1.78947 WP_003091733.1.78954 WP_003091733.1.7899 WP_003091733.1.79003 WP_003091733.1.79007 WP_003091733.1.79053 WP_003091733.1.79060 WP_003091733.1.79177 WP_003091733.1.79279 WP_003091733.1.79286 WP_003091733.1.79311 WP_003091733.1.79364 WP_003091733.1.79421 WP_003091733.1.79431 WP_003091733.1.7945 WP_003091733.1.79463 WP_003091733.1.79507 WP_003091733.1.7953 WP_003091733.1.79544 WP_003091733.1.79569 WP_003091733.1.79601 WP_003091733.1.79631 WP_003091733.1.79699 WP_003091733.1.79754 WP_003091733.1.79788 WP_003091733.1.79862 WP_003091733.1.79883 WP_003091733.1.799 WP_003091733.1.79902 WP_003091733.1.79986 WP_003091733.1.8 WP_003091733.1.80068 WP_003091733.1.80102 WP_003091733.1.8013 WP_003091733.1.80174 WP_003091733.1.80306 WP_003091733.1.8038 WP_003091733.1.80410 WP_003091733.1.80411 WP_003091733.1.80454 WP_003091733.1.80481 WP_003091733.1.8051 WP_003091733.1.80535 WP_003091733.1.80572 WP_003091733.1.80627 WP_003091733.1.80632 WP_003091733.1.8064 WP_003091733.1.80645 WP_003091733.1.80683 WP_003091733.1.80715 WP_003091733.1.80720 WP_003091733.1.80785 WP_003091733.1.80846 WP_003091733.1.80892 WP_003091733.1.80910 WP_003091733.1.80926 WP_003091733.1.80931 WP_003091733.1.80938 WP_003091733.1.80969 WP_003091733.1.81082 WP_003091733.1.8110 WP_003091733.1.81206 WP_003091733.1.81237 WP_003091733.1.81338 WP_003091733.1.81349 WP_003091733.1.81368 WP_003091733.1.81380 WP_003091733.1.8141 WP_003091733.1.81426 WP_003091733.1.81470 WP_003091733.1.81482 WP_003091733.1.81487 WP_003091733.1.81581 WP_003091733.1.81591 WP_003091733.1.81708 WP_003091733.1.81728 WP_003091733.1.81742 WP_003091733.1.81784 WP_003091733.1.81802 WP_003091733.1.81834 WP_003091733.1.81844 WP_003091733.1.81856 WP_003091733.1.81874 WP_003091733.1.81927 WP_003091733.1.81950 WP_003091733.1.82117 WP_003091733.1.82127 WP_003091733.1.82260 WP_003091733.1.82310 WP_003091733.1.82328 WP_003091733.1.8238 WP_003091733.1.82604 WP_003091733.1.82606 WP_003091733.1.82643 WP_003091733.1.82686 WP_003091733.1.82710 WP_003091733.1.82798 WP_003091733.1.82810 WP_003091733.1.82864 WP_003091733.1.82882 WP_003091733.1.82936 WP_003091733.1.83025 WP_003091733.1.83131 WP_003091733.1.83184 WP_003091733.1.83251 WP_003091733.1.83267 WP_003091733.1.83296 WP_003091733.1.83317 WP_003091733.1.83374 WP_003091733.1.83394 WP_003091733.1.83440 WP_003091733.1.83460 WP_003091733.1.835 WP_003091733.1.83503 WP_003091733.1.8351 WP_003091733.1.8353 WP_003091733.1.83534 WP_003091733.1.83540 WP_003091733.1.8357 WP_003091733.1.83637 WP_003091733.1.83673 WP_003091733.1.83715 WP_003091733.1.83871 WP_003091733.1.83937 WP_003091733.1.83946 WP_003091733.1.84003 WP_003091733.1.84008 WP_003091733.1.84138 WP_003091733.1.84174 WP_003091733.1.84177 WP_003091733.1.84178 WP_003091733.1.84190 WP_003091733.1.84203 WP_003091733.1.84297 WP_003091733.1.8437 WP_003091733.1.84374 WP_003091733.1.84404 WP_003091733.1.84439 WP_003091733.1.84526 WP_003091733.1.8453 WP_003091733.1.84558 WP_003091733.1.84589 WP_003091733.1.84674 WP_003091733.1.84684 WP_003091733.1.84702 WP_003091733.1.84754 WP_003091733.1.84792 WP_003091733.1.84825 WP_003091733.1.8484 WP_003091733.1.84865 WP_003091733.1.85018 WP_003091733.1.85028 WP_003091733.1.85059 WP_003091733.1.85150 WP_003091733.1.85220 WP_003091733.1.85290 WP_003091733.1.85311 WP_003091733.1.85318 WP_003091733.1.85453 WP_003091733.1.85633 WP_003091733.1.85638 WP_003091733.1.85788 WP_003091733.1.85897 WP_003091733.1.85910 WP_003091733.1.85920 WP_003091733.1.85978 WP_003091733.1.86002 WP_003091733.1.86047 WP_003091733.1.86058 WP_003091733.1.861 WP_003091733.1.86125 WP_003091733.1.86182 WP_003091733.1.86243 WP_003091733.1.86278 WP_003091733.1.86293 WP_003091733.1.86386 WP_003091733.1.86432 WP_003091733.1.8645 WP_003091733.1.865 WP_003091733.1.86506 WP_003091733.1.86545 WP_003091733.1.86552 WP_003091733.1.86554 WP_003091733.1.86595 WP_003091733.1.86652 WP_003091733.1.86665 WP_003091733.1.867 WP_003091733.1.86708 WP_003091733.1.86785 WP_003091733.1.86796 WP_003091733.1.86822 WP_003091733.1.8693 WP_003091733.1.86947 WP_003091733.1.86970 WP_003091733.1.86985 WP_003091733.1.87104 WP_003091733.1.87163 WP_003091733.1.8718 WP_003091733.1.87182 WP_003091733.1.8727 WP_003091733.1.87316 WP_003091733.1.87390 WP_003091733.1.87435 WP_003091733.1.87463 WP_003091733.1.8749 WP_003091733.1.87530 WP_003091733.1.87648 WP_003091733.1.87763 WP_003091733.1.8777 WP_003091733.1.8785 WP_003091733.1.87877 WP_003091733.1.87888 WP_003091733.1.87975 WP_003091733.1.87981 WP_003091733.1.87987 WP_003091733.1.88388 WP_003091733.1.88415 WP_003091733.1.88540 WP_003091733.1.88550 WP_003091733.1.88578 WP_003091733.1.88605 WP_003091733.1.88659 WP_003091733.1.88679 WP_003091733.1.88680 WP_003091733.1.88714 WP_003091733.1.88750 WP_003091733.1.88796 WP_003091733.1.889 WP_003091733.1.88949 WP_003091733.1.89098 WP_003091733.1.8911 WP_003091733.1.89245 WP_003091733.1.89266 WP_003091733.1.89276 WP_003091733.1.89330 WP_003091733.1.89409 WP_003091733.1.89480 WP_003091733.1.8949 WP_003091733.1.89491 WP_003091733.1.89523 WP_003091733.1.89577 WP_003091733.1.89638 WP_003091733.1.89662 WP_003091733.1.89669 WP_003091733.1.89736 WP_003091733.1.8976 WP_003091733.1.89776 WP_003091733.1.89805 WP_003091733.1.89866 WP_003091733.1.89867 WP_003091733.1.89871 WP_003091733.1.89992 WP_003091733.1.90024 WP_003091733.1.90032 WP_003091733.1.90056 WP_003091733.1.90150 WP_003091733.1.90189 WP_003091733.1.90224 WP_003091733.1.90225 WP_003091733.1.90242 WP_003091733.1.90272 WP_003091733.1.90306 WP_003091733.1.90412 WP_003091733.1.9056 WP_003091733.1.90569 WP_003091733.1.90655 WP_003091733.1.90770 WP_003091733.1.90940 WP_003091733.1.91012 WP_003091733.1.91093 WP_003091733.1.91161 WP_003091733.1.9120 WP_003091733.1.91204 WP_003091733.1.91236 WP_003091733.1.91281 WP_003091733.1.91307 WP_003091733.1.91392 WP_003091733.1.91416 WP_003091733.1.9143 WP_003091733.1.91431 WP_003091733.1.91467 WP_003091733.1.91527 WP_003091733.1.91563 WP_003091733.1.91585 WP_003091733.1.91796 WP_003091733.1.91803 WP_003091733.1.9182 WP_003091733.1.91846 WP_003091733.1.91862 WP_003091733.1.91882 WP_003091733.1.9191 WP_003091733.1.91943 WP_003091733.1.92043 WP_003091733.1.9219 WP_003091733.1.92314 WP_003091733.1.92321 WP_003091733.1.92357 WP_003091733.1.92454 WP_003091733.1.92573 WP_003091733.1.92585 WP_003091733.1.92587 WP_003091733.1.92594 WP_003091733.1.92624 WP_003091733.1.92630 WP_003091733.1.92759 WP_003091733.1.92769 WP_003091733.1.92839 WP_003091733.1.92847 WP_003091733.1.92894 WP_003091733.1.92924 WP_003091733.1.92930 WP_003091733.1.93001 WP_003091733.1.93090 WP_003091733.1.93122 WP_003091733.1.93130 WP_003091733.1.93144 WP_003091733.1.93148 WP_003091733.1.93196 WP_003091733.1.93250 WP_003091733.1.93264 WP_003091733.1.9328 WP_003091733.1.9349 WP_003091733.1.93493 WP_003091733.1.93498 WP_003091733.1.93520 WP_003091733.1.93568 WP_003091733.1.93797 WP_003091733.1.93848 WP_003091733.1.93889 WP_003091733.1.93897 WP_003091733.1.94004 WP_003091733.1.94031 WP_003091733.1.94065 WP_003091733.1.94078 WP_003091733.1.94174 WP_003091733.1.94218 WP_003091733.1.94230 WP_003091733.1.94243 WP_003091733.1.94285 WP_003091733.1.94288 WP_003091733.1.94333 WP_003091733.1.94349 WP_003091733.1.94450 WP_003091733.1.94682 WP_003091733.1.94732 WP_003091733.1.94742 WP_003091733.1.94814 WP_003091733.1.94818 WP_003091733.1.94856 WP_003091733.1.94874 WP_003091733.1.94881 WP_003091733.1.94896 WP_003091733.1.94897 WP_003091733.1.94943 WP_003091733.1.95018 WP_003091733.1.95025 WP_003091733.1.95027 WP_003091733.1.95117 WP_003091733.1.95187 WP_003091733.1.95207 WP_003091733.1.95217 WP_003091733.1.95305 WP_003091733.1.95354 WP_003091733.1.95460 WP_003091733.1.95488 WP_003091733.1.95525 WP_003091733.1.95536 WP_003091733.1.95668 WP_003091733.1.95774 WP_003091733.1.95782 WP_003091733.1.95787 WP_003091733.1.95820 WP_003091733.1.95825 WP_003091733.1.95959 WP_003091733.1.9599 WP_003091733.1.95994 WP_003091733.1.95999 WP_003091733.1.9604 WP_003091733.1.96041 WP_003091733.1.96058 WP_003091733.1.961 WP_003091733.1.96134 WP_003091733.1.96193 WP_003091733.1.96243 WP_003091733.1.96267 WP_003091733.1.96357 WP_003091733.1.96434 WP_003091733.1.96506 WP_003091733.1.96702 WP_003091733.1.96863 WP_003091733.1.96880 WP_003091733.1.96967 WP_003091733.1.97118 WP_003091733.1.97204 WP_003091733.1.97213 WP_003091733.1.9722 WP_003091733.1.97272 WP_003091733.1.97377 WP_003091733.1.97461 WP_003091733.1.97474 WP_003091733.1.97499 WP_003091733.1.97503 WP_003091733.1.97521 WP_003091733.1.97614 WP_003091733.1.97784 WP_003091733.1.97826 WP_003091733.1.97877 WP_003091733.1.97968 WP_003091733.1.98111 WP_003091733.1.98276 WP_003091733.1.98308 WP_003091733.1.98410 WP_003091733.1.98414 WP_003091733.1.98433 WP_003091733.1.9845 WP_003091733.1.985 WP_003091733.1.98573 WP_003091733.1.98610 WP_003091733.1.98678 WP_003091733.1.98718 WP_003091733.1.98788 WP_003091733.1.98814 WP_003091733.1.9885 WP_003091733.1.98873 WP_003091733.1.98907 WP_003091733.1.98926 WP_003091733.1.98958 WP_003091733.1.98960 WP_003091733.1.98963 WP_003091733.1.99065 WP_003091733.1.99068 WP_003091733.1.99103 WP_003091733.1.99214 WP_003091733.1.99293 WP_003091733.1.99353 WP_003091733.1.99378 WP_003091733.1.99386 WP_003091733.1.99443 WP_003091733.1.99461 WP_003091733.1.99647 WP_003091733.1.99654 WP_003091733.1.99662 WP_003091733.1.99746 WP_003091733.1.99757 WP_003091733.1.99772 WP_003091733.1.99795 WP_003091733.1.99835 WP_003091733.1.9989 WP_003091733.1.99930 gi|386057680|ref|YP_005974202.1| gi|514410578|ref|YP_008133990.1| gi|392982910|ref|YP_006481497.1| gi|218890452|ref|YP_002439316.1| gi|564951501|ref|YP_008884071.1| gi|568152858|ref|YP_008941814.1| gi|116051367|ref|YP_789800.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]