SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|386067969|ref|YP_005983273.1| from Pseudomonas aeruginosa NCGM2.S1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|386067969|ref|YP_005983273.1|
Domain Number 1 Region: 512-608
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 0.00000000000000877
Family Histidine kinase 0.024
Further Details:      
 
Domain Number 2 Region: 193-242
Classification Level Classification E-value
Superfamily HAMP domain-like 0.00000000106
Family HAMP domain 0.0047
Further Details:      
 
Weak hits

Sequence:  gi|386067969|ref|YP_005983273.1|
Domain Number - Region: 252-393
Classification Level Classification E-value
Superfamily GAF domain-like 0.000883
Family GAF domain 0.025
Further Details:      
 
Domain Number - Region: 88-132
Classification Level Classification E-value
Superfamily FlgN-like 0.0745
Family FlgN-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|386067969|ref|YP_005983273.1|
Sequence length 622
Comment two-component sensor [Pseudomonas aeruginosa NCGM2.S1]
Sequence
MNKATAPDADQRDRFFGGSDRAGKPILRRSLVVRFGCYLTLLVSLALIGMFSALLFADYT
HQDAAVINHAGSLRMLTYRVALEPSLEGRQALLGTLGERLDSGDIRRLLQRQDADDPIRQ
LHQELREGLARLDPRALPGRAVLDAYVGDIDRFVGILQAKAERRSQLLSTVQGLCLFLSL
LVVFVTLYDLSYHVIGPLRELTSTARRLGRGELDARVTYSGEDELAQLGERFNQMAGELK
SIYGDLEERVEDKTRALSQSHQRLELLYASARRLGENPYDSRTLQPLLNQLEKVLDAGRV
TLCLNKDGVERAYSSLTTTERPADFCLQGDCGSCREQASACDQPSSLAQPLLMQPLSIAG
HRFGELFIESRSGRLENWQQQLIETFCDNIARTFALSLQQEQESRLALFAERGTIARELH
DSLAQSLSYLKIQVSRLGTLLKREAPAEKIEDTLDELREGLNGAYRQLRELLTTFRLSLD
EPSLEAALGNAVAEFGERGEVAIELDNRLQHVPLSPNEEIHVLQIVREALSNVVRHSQAQ
RAWVRLSSQADGQVSIAVEDDGVGFDPQQNRSGHYGLTIMQERGQTLGSQLRFEARAPHG
TRVLFSFVPTALQPSAAKEPTP
Download sequence
Identical sequences A0A077JS01 A0A0E1AQ98 A0A0H2ZE97 A0A157TZY2 V6AAT1 W1MGJ2
WP_003092966.1.100278 WP_003092966.1.100476 WP_003092966.1.101269 WP_003092966.1.10174 WP_003092966.1.10202 WP_003092966.1.10228 WP_003092966.1.10248 WP_003092966.1.10271 WP_003092966.1.10548 WP_003092966.1.10575 WP_003092966.1.10764 WP_003092966.1.10895 WP_003092966.1.11130 WP_003092966.1.11318 WP_003092966.1.1183 WP_003092966.1.12150 WP_003092966.1.12200 WP_003092966.1.12400 WP_003092966.1.12547 WP_003092966.1.12660 WP_003092966.1.12744 WP_003092966.1.12890 WP_003092966.1.13041 WP_003092966.1.13077 WP_003092966.1.13085 WP_003092966.1.13092 WP_003092966.1.13270 WP_003092966.1.13364 WP_003092966.1.13533 WP_003092966.1.13718 WP_003092966.1.13743 WP_003092966.1.14116 WP_003092966.1.14251 WP_003092966.1.14476 WP_003092966.1.14679 WP_003092966.1.14690 WP_003092966.1.14815 WP_003092966.1.14883 WP_003092966.1.14981 WP_003092966.1.15004 WP_003092966.1.1516 WP_003092966.1.15408 WP_003092966.1.15666 WP_003092966.1.15934 WP_003092966.1.16751 WP_003092966.1.16788 WP_003092966.1.16801 WP_003092966.1.16811 WP_003092966.1.1704 WP_003092966.1.17108 WP_003092966.1.17177 WP_003092966.1.17189 WP_003092966.1.17223 WP_003092966.1.1761 WP_003092966.1.18156 WP_003092966.1.18157 WP_003092966.1.18440 WP_003092966.1.18508 WP_003092966.1.18795 WP_003092966.1.18907 WP_003092966.1.19089 WP_003092966.1.19199 WP_003092966.1.19251 WP_003092966.1.19346 WP_003092966.1.19351 WP_003092966.1.19640 WP_003092966.1.19711 WP_003092966.1.19718 WP_003092966.1.19803 WP_003092966.1.19824 WP_003092966.1.2012 WP_003092966.1.20590 WP_003092966.1.20825 WP_003092966.1.20880 WP_003092966.1.20890 WP_003092966.1.20978 WP_003092966.1.21002 WP_003092966.1.21039 WP_003092966.1.21096 WP_003092966.1.21253 WP_003092966.1.23166 WP_003092966.1.2355 WP_003092966.1.23938 WP_003092966.1.24183 WP_003092966.1.24234 WP_003092966.1.24319 WP_003092966.1.24413 WP_003092966.1.2530 WP_003092966.1.25641 WP_003092966.1.25834 WP_003092966.1.26473 WP_003092966.1.26553 WP_003092966.1.26682 WP_003092966.1.26862 WP_003092966.1.27288 WP_003092966.1.27549 WP_003092966.1.27933 WP_003092966.1.28699 WP_003092966.1.28757 WP_003092966.1.28878 WP_003092966.1.29003 WP_003092966.1.29008 WP_003092966.1.29070 WP_003092966.1.29127 WP_003092966.1.29650 WP_003092966.1.30020 WP_003092966.1.30563 WP_003092966.1.30615 WP_003092966.1.30625 WP_003092966.1.30842 WP_003092966.1.31457 WP_003092966.1.31633 WP_003092966.1.31655 WP_003092966.1.31751 WP_003092966.1.319 WP_003092966.1.32235 WP_003092966.1.32359 WP_003092966.1.32626 WP_003092966.1.32637 WP_003092966.1.32821 WP_003092966.1.32998 WP_003092966.1.33009 WP_003092966.1.33047 WP_003092966.1.33294 WP_003092966.1.33438 WP_003092966.1.33517 WP_003092966.1.33547 WP_003092966.1.33669 WP_003092966.1.3368 WP_003092966.1.33728 WP_003092966.1.33833 WP_003092966.1.33945 WP_003092966.1.34180 WP_003092966.1.3436 WP_003092966.1.34461 WP_003092966.1.34556 WP_003092966.1.34670 WP_003092966.1.35442 WP_003092966.1.35529 WP_003092966.1.3555 WP_003092966.1.35968 WP_003092966.1.36064 WP_003092966.1.36121 WP_003092966.1.36148 WP_003092966.1.36267 WP_003092966.1.36285 WP_003092966.1.36608 WP_003092966.1.36708 WP_003092966.1.36756 WP_003092966.1.373 WP_003092966.1.3742 WP_003092966.1.37571 WP_003092966.1.3768 WP_003092966.1.37703 WP_003092966.1.38023 WP_003092966.1.38060 WP_003092966.1.38335 WP_003092966.1.38510 WP_003092966.1.38582 WP_003092966.1.38587 WP_003092966.1.3870 WP_003092966.1.39765 WP_003092966.1.39920 WP_003092966.1.40115 WP_003092966.1.40271 WP_003092966.1.40442 WP_003092966.1.40984 WP_003092966.1.40993 WP_003092966.1.41110 WP_003092966.1.41137 WP_003092966.1.41199 WP_003092966.1.41290 WP_003092966.1.41429 WP_003092966.1.41703 WP_003092966.1.4196 WP_003092966.1.42 WP_003092966.1.42047 WP_003092966.1.42316 WP_003092966.1.42381 WP_003092966.1.42411 WP_003092966.1.42499 WP_003092966.1.42690 WP_003092966.1.42723 WP_003092966.1.4273 WP_003092966.1.42870 WP_003092966.1.42946 WP_003092966.1.43245 WP_003092966.1.43286 WP_003092966.1.43326 WP_003092966.1.43696 WP_003092966.1.43756 WP_003092966.1.4397 WP_003092966.1.43998 WP_003092966.1.44269 WP_003092966.1.44486 WP_003092966.1.44552 WP_003092966.1.44725 WP_003092966.1.44804 WP_003092966.1.44870 WP_003092966.1.45298 WP_003092966.1.45353 WP_003092966.1.45635 WP_003092966.1.45636 WP_003092966.1.45678 WP_003092966.1.45700 WP_003092966.1.45946 WP_003092966.1.46010 WP_003092966.1.46306 WP_003092966.1.4640 WP_003092966.1.47314 WP_003092966.1.47374 WP_003092966.1.47551 WP_003092966.1.48472 WP_003092966.1.48487 WP_003092966.1.48579 WP_003092966.1.48840 WP_003092966.1.48851 WP_003092966.1.49108 WP_003092966.1.49244 WP_003092966.1.49948 WP_003092966.1.50450 WP_003092966.1.50459 WP_003092966.1.50691 WP_003092966.1.50783 WP_003092966.1.50814 WP_003092966.1.50922 WP_003092966.1.51035 WP_003092966.1.51585 WP_003092966.1.51727 WP_003092966.1.51928 WP_003092966.1.51957 WP_003092966.1.52043 WP_003092966.1.52212 WP_003092966.1.52372 WP_003092966.1.52403 WP_003092966.1.52409 WP_003092966.1.52500 WP_003092966.1.52790 WP_003092966.1.52850 WP_003092966.1.5289 WP_003092966.1.52939 WP_003092966.1.53038 WP_003092966.1.53414 WP_003092966.1.53586 WP_003092966.1.53678 WP_003092966.1.53946 WP_003092966.1.54003 WP_003092966.1.54076 WP_003092966.1.54293 WP_003092966.1.54354 WP_003092966.1.55 WP_003092966.1.55387 WP_003092966.1.56452 WP_003092966.1.56465 WP_003092966.1.56626 WP_003092966.1.56864 WP_003092966.1.57020 WP_003092966.1.57065 WP_003092966.1.57339 WP_003092966.1.57369 WP_003092966.1.57417 WP_003092966.1.57792 WP_003092966.1.57841 WP_003092966.1.57853 WP_003092966.1.57921 WP_003092966.1.57966 WP_003092966.1.58200 WP_003092966.1.58360 WP_003092966.1.58417 WP_003092966.1.5850 WP_003092966.1.58510 WP_003092966.1.5856 WP_003092966.1.58581 WP_003092966.1.58800 WP_003092966.1.58838 WP_003092966.1.58845 WP_003092966.1.58944 WP_003092966.1.58952 WP_003092966.1.5897 WP_003092966.1.59158 WP_003092966.1.59212 WP_003092966.1.59376 WP_003092966.1.59943 WP_003092966.1.60062 WP_003092966.1.60084 WP_003092966.1.60364 WP_003092966.1.60396 WP_003092966.1.60472 WP_003092966.1.60679 WP_003092966.1.60970 WP_003092966.1.61122 WP_003092966.1.61288 WP_003092966.1.61294 WP_003092966.1.61589 WP_003092966.1.616 WP_003092966.1.626 WP_003092966.1.62604 WP_003092966.1.62703 WP_003092966.1.62708 WP_003092966.1.62838 WP_003092966.1.62961 WP_003092966.1.62977 WP_003092966.1.63591 WP_003092966.1.63739 WP_003092966.1.63784 WP_003092966.1.63929 WP_003092966.1.63941 WP_003092966.1.64212 WP_003092966.1.6450 WP_003092966.1.64544 WP_003092966.1.64605 WP_003092966.1.6461 WP_003092966.1.64611 WP_003092966.1.64886 WP_003092966.1.65009 WP_003092966.1.65312 WP_003092966.1.65478 WP_003092966.1.65632 WP_003092966.1.66088 WP_003092966.1.66155 WP_003092966.1.6629 WP_003092966.1.66693 WP_003092966.1.66982 WP_003092966.1.67124 WP_003092966.1.67489 WP_003092966.1.67506 WP_003092966.1.67874 WP_003092966.1.67875 WP_003092966.1.67899 WP_003092966.1.67937 WP_003092966.1.6796 WP_003092966.1.68172 WP_003092966.1.68499 WP_003092966.1.68979 WP_003092966.1.6911 WP_003092966.1.69209 WP_003092966.1.69411 WP_003092966.1.70138 WP_003092966.1.70331 WP_003092966.1.70537 WP_003092966.1.70650 WP_003092966.1.71141 WP_003092966.1.71234 WP_003092966.1.71249 WP_003092966.1.71290 WP_003092966.1.71610 WP_003092966.1.7163 WP_003092966.1.71738 WP_003092966.1.71866 WP_003092966.1.7219 WP_003092966.1.72458 WP_003092966.1.72477 WP_003092966.1.72662 WP_003092966.1.72727 WP_003092966.1.72782 WP_003092966.1.72845 WP_003092966.1.72920 WP_003092966.1.73035 WP_003092966.1.7308 WP_003092966.1.73192 WP_003092966.1.73719 WP_003092966.1.7377 WP_003092966.1.73791 WP_003092966.1.74182 WP_003092966.1.74281 WP_003092966.1.74287 WP_003092966.1.74326 WP_003092966.1.7448 WP_003092966.1.74685 WP_003092966.1.74958 WP_003092966.1.7501 WP_003092966.1.75119 WP_003092966.1.75431 WP_003092966.1.75580 WP_003092966.1.75603 WP_003092966.1.7568 WP_003092966.1.75756 WP_003092966.1.76077 WP_003092966.1.76141 WP_003092966.1.76775 WP_003092966.1.77238 WP_003092966.1.78118 WP_003092966.1.78148 WP_003092966.1.7840 WP_003092966.1.78425 WP_003092966.1.78599 WP_003092966.1.788 WP_003092966.1.7899 WP_003092966.1.79421 WP_003092966.1.79754 WP_003092966.1.799 WP_003092966.1.79902 WP_003092966.1.80087 WP_003092966.1.80102 WP_003092966.1.8038 WP_003092966.1.80454 WP_003092966.1.80683 WP_003092966.1.80715 WP_003092966.1.80785 WP_003092966.1.80910 WP_003092966.1.80969 WP_003092966.1.81081 WP_003092966.1.81338 WP_003092966.1.81349 WP_003092966.1.81368 WP_003092966.1.81380 WP_003092966.1.81426 WP_003092966.1.81470 WP_003092966.1.81708 WP_003092966.1.81816 WP_003092966.1.81856 WP_003092966.1.81874 WP_003092966.1.81927 WP_003092966.1.82686 WP_003092966.1.82810 WP_003092966.1.83213 WP_003092966.1.83267 WP_003092966.1.83317 WP_003092966.1.83374 WP_003092966.1.83440 WP_003092966.1.83503 WP_003092966.1.8351 WP_003092966.1.83540 WP_003092966.1.83937 WP_003092966.1.84138 WP_003092966.1.84558 WP_003092966.1.84684 WP_003092966.1.84825 WP_003092966.1.85150 WP_003092966.1.85638 WP_003092966.1.85920 WP_003092966.1.85978 WP_003092966.1.86182 WP_003092966.1.86243 WP_003092966.1.86432 WP_003092966.1.8645 WP_003092966.1.86506 WP_003092966.1.86595 WP_003092966.1.86665 WP_003092966.1.86796 WP_003092966.1.86813 WP_003092966.1.86970 WP_003092966.1.87390 WP_003092966.1.8777 WP_003092966.1.8785 WP_003092966.1.87888 WP_003092966.1.88540 WP_003092966.1.88796 WP_003092966.1.889 WP_003092966.1.89330 WP_003092966.1.89871 WP_003092966.1.89992 WP_003092966.1.90272 WP_003092966.1.91012 WP_003092966.1.91236 WP_003092966.1.91392 WP_003092966.1.91527 WP_003092966.1.91882 WP_003092966.1.92594 WP_003092966.1.92630 WP_003092966.1.93122 WP_003092966.1.93196 WP_003092966.1.93520 WP_003092966.1.93568 WP_003092966.1.93889 WP_003092966.1.94065 WP_003092966.1.94078 WP_003092966.1.94230 WP_003092966.1.94288 WP_003092966.1.94333 WP_003092966.1.94349 WP_003092966.1.94881 WP_003092966.1.94943 WP_003092966.1.95018 WP_003092966.1.95354 WP_003092966.1.95745 WP_003092966.1.95751 WP_003092966.1.95782 WP_003092966.1.95959 WP_003092966.1.96058 WP_003092966.1.961 WP_003092966.1.96863 WP_003092966.1.97204 WP_003092966.1.97377 WP_003092966.1.97461 WP_003092966.1.97488 WP_003092966.1.97499 WP_003092966.1.97503 WP_003092966.1.97521 WP_003092966.1.97583 WP_003092966.1.97784 WP_003092966.1.98111 WP_003092966.1.9845 WP_003092966.1.985 WP_003092966.1.98672 WP_003092966.1.98873 WP_003092966.1.98963 WP_003092966.1.99065 WP_003092966.1.99378 WP_003092966.1.99443 WP_003092966.1.99772 gi|564950979|ref|YP_008883549.1| gi|478477261|ref|YP_007707912.1| gi|116051914|ref|YP_789243.1| 208963.PA14_13740 gi|386067969|ref|YP_005983273.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]