SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328949863|ref|YP_004367198.1| from Marinithermus hydrothermalis DSM 14884

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328949863|ref|YP_004367198.1|
Domain Number 1 Region: 2-256
Classification Level Classification E-value
Superfamily Folate-binding domain 1.73e-55
Family Aminomethyltransferase folate-binding domain 0.0013
Further Details:      
 
Domain Number 2 Region: 255-330
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 0.00000867
Family Aminomethyltransferase beta-barrel domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328949863|ref|YP_004367198.1|
Sequence length 330
Comment folate-binding protein YgfZ [Marinithermus hydrothermalis DSM 14884]
Sequence
MSGLKRLHDALGAVYAEVRGVAVPWRYGNEAAEHAALRTGAGLVDQSERGVLALSGADRV
DFLNGQCTANIKALTPGGVVEALFLNARGQVELFGTVYHRGEALWITAPSGMSQALEARF
RRYIIFDQVALEPFEAAQFRLVGPKAGEVLGRAGYALPEAGRFVEVKGGLLARDAHGYAL
VVPVEDAEAAWRALCAAGATPVGRGALEVWRVERGIPDLPEALGRLPQEVGLEDLVHPGK
GCYLGQEIMARLEARGNVRRRLMGLRLGEVVPSGAEVTHEGRAVGQVGTVVRSPRLGAVA
LAVLGKALEPGDRVEVGGVAAEVAALPFVD
Download sequence
Identical sequences F2NPY7
gi|328949863|ref|YP_004367198.1| WP_013703143.1.12164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]