SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328950289|ref|YP_004367624.1| from Marinithermus hydrothermalis DSM 14884

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328950289|ref|YP_004367624.1|
Domain Number 1 Region: 5-126
Classification Level Classification E-value
Superfamily Frataxin/Nqo15-like 1.78e-53
Family Nqo15-like 0.00000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328950289|ref|YP_004367624.1|
Sequence length 136
Comment NADH dehydrogenase (quinone) [Marinithermus hydrothermalis DSM 14884]
Sequence
MSENHDKALYEAWVEVLDWLKAYAVERGVRFEWEADFPDYIYRMHRPYDLPTRVMTVSLS
DERGEPFFLADVSPRHAKLKQISFRVPGGHLHWHAHYEEGRGLVLGGKIPLTKEKLYQLA
DRARHHVDERRVERVS
Download sequence
Identical sequences F2NM44
WP_013703566.1.12164 gi|328950289|ref|YP_004367624.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]