SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|328950310|ref|YP_004367645.1| from Marinithermus hydrothermalis DSM 14884

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328950310|ref|YP_004367645.1|
Domain Number 1 Region: 1-267
Classification Level Classification E-value
Superfamily Folate-binding domain 5.65e-98
Family Aminomethyltransferase folate-binding domain 0.00000029
Further Details:      
 
Domain Number 2 Region: 267-350
Classification Level Classification E-value
Superfamily Aminomethyltransferase beta-barrel domain 4.58e-24
Family Aminomethyltransferase beta-barrel domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|328950310|ref|YP_004367645.1|
Sequence length 354
Comment aminomethyltransferase [Marinithermus hydrothermalis DSM 14884]
Sequence
MKHTPLYENHQKLGARMVDFAGWAMPIQYTSINAEHLAVRQGVGVFDVSHMGEFWVRGPE
ALEFLQYVTLNDAARLKVGRAQYSMLPNANGGVVDDVYLYRTGEREYLMVVNAANIEKDF
AHLAAIAPRYKVELEDASADWALLAVQGPQAEALLAGLVDVPLAEKRKNSVFEARLAGRP
ARLARTGYTGEDGFEVFVRPEDAPAVWEALLEAGAVPCGLGARDTLRLEAGFALYGHELT
DETNPRCTPFAWVVKEHKEFLGKPALLAGDCRERLVGLVLERGVPRAGYTVLREGRPVGR
VTSGTMSPVLRKGIALAYVEEAFAEEGTELLVEVRGKPYPARVVKPPFVPLGKK
Download sequence
Identical sequences F2NM65
WP_013703587.1.12164 gi|328950310|ref|YP_004367645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]