SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|328951113|ref|YP_004368448.1| from Marinithermus hydrothermalis DSM 14884

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|328951113|ref|YP_004368448.1|
Domain Number 1 Region: 78-188
Classification Level Classification E-value
Superfamily V-type ATPase subunit E-like 1.44e-17
Family V-type ATPase subunit E 0.0018
Further Details:      
 
Weak hits

Sequence:  gi|328951113|ref|YP_004368448.1|
Domain Number - Region: 14-106
Classification Level Classification E-value
Superfamily OmpH-like 0.00968
Family OmpH-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|328951113|ref|YP_004368448.1|
Sequence length 188
Comment V-type proton ATPase subunit E [Marinithermus hydrothermalis DSM 14884]
Sequence
MPKLENILQEEVLAEINGLLAEAEAKAGTLLREAQEQAEALKASRQRALEAERAAALKRA
KSAAELQVATARMKAKGEVVDQVYAKVLEALEGLAAKPEYAEVLQKLAEEAVGALGEAEA
VVVNPEDAAHLQTWAQERGLELRTDAQLRLGVRVVAKGGKSQVENTLPERLERAWETLSA
RVAQILWG
Download sequence
Identical sequences F2NK89
gi|328951113|ref|YP_004368448.1| WP_013704385.1.12164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]