SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334335967|ref|YP_004541119.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334335967|ref|YP_004541119.1|
Domain Number 1 Region: 294-536
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.91e-30
Family Crotonase-like 0.0034
Further Details:      
 
Domain Number 2 Region: 4-158
Classification Level Classification E-value
Superfamily Formyltransferase 2.35e-18
Family Formyltransferase 0.002
Further Details:      
 
Domain Number 3 Region: 181-257
Classification Level Classification E-value
Superfamily FMT C-terminal domain-like 0.0000000000000647
Family Post formyltransferase domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334335967|ref|YP_004541119.1|
Sequence length 551
Comment formyl transferase domain-containing protein [Isoptericola variabilis 225]
Sequence
MRILLLVSAFNGLTQRVWCHLTGAGHDVGVELAPVFATPEDLVAAVEDIAPDLILAPFLK
HRVPEQVWRRWTTVVVHPGPVGDRGPSSLDHAILDGRERWGVTALSAVEEMDAGPVWATS
TFAMPAVPLAKSALYNGPVADAAMRCVDEVLRKVAAGEGPTPADDLPREVAGTGELPLLR
RAAFELDWSLPAADLARRVAAADGAPGAPATVGGRRVCLFDAVATAQDLGGTPGAVVGHD
GDAVAFATGDGVLWVGYAAELAERRGPKLPARLVLDPQRRSPYREAPEQLAEAVYERDGD
VGYLTFRSYNGAMHTEQCLRLAAAVEKALTEDTRVLVLRGTEHTFSNGIHLGMIDAAEDP
AAEAWANIQAIDDLCEAIARAEQTTVAAITANAGAGGVMAALCADVVVARDGVVLNPYYD
MGIYGSELHTWALPARVGAETADALLQDKLPVGATRARELGLVDAVGPRDPEAFAAWLAE
RAREGGSGDARREGLGADAAGRPLSYYRTVELAEMARDLFDDRNGFAGRRRDFLRKAAPT
ETPERLRFPRA
Download sequence
Identical sequences F6FU29
gi|334335967|ref|YP_004541119.1| WP_013837620.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]