SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|334336159|ref|YP_004541311.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334336159|ref|YP_004541311.1|
Domain Number 1 Region: 146-209
Classification Level Classification E-value
Superfamily PGBD-like 2.62e-18
Family Peptidoglycan binding domain, PGBD 0.0035
Further Details:      
 
Domain Number 2 Region: 221-342
Classification Level Classification E-value
Superfamily L,D-transpeptidase catalytic domain-like 3.53e-17
Family L,D-transpeptidase catalytic domain-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334336159|ref|YP_004541311.1|
Sequence length 343
Comment ErfK/YbiS/YcfS/YnhG family protein [Isoptericola variabilis 225]
Sequence
MTTERTTARRRRPAAAAATALALFLLPGCAMLDDGAEPEPGSAPAAEAPTTAAPSATPSG
ETSAEPDASSAPSAAPSTTPSSTPSAEADAPDPGAGPSASPSAEGDDAPGEGAGNGQTNG
NGNANGNANGNGKGNGKDAQEEKPEHLERGATGERVAALQQRLQDLGYFLPEVDGSFGPA
TQQAVWALQKAAGLHRDGVVGPKTQAALDQGVRPSPVSSSGKVVEIDLDRQLLLAVEDGR
VVRTINASSGNGETFEALGRTYRATTPRGTFAVYMERDYLHESTLELGAMYRPKYFTGGI
AVHGSPSIPPYPASHGCVRVSNSAMNWLWDSWGMPKGTTVVVH
Download sequence
Identical sequences F6FVT7
gi|334336159|ref|YP_004541311.1| WP_013837811.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]