SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334336292|ref|YP_004541444.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334336292|ref|YP_004541444.1|
Domain Number 1 Region: 16-211
Classification Level Classification E-value
Superfamily Formyltransferase 2.75e-57
Family Formyltransferase 0.0000155
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334336292|ref|YP_004541444.1|
Sequence length 214
Comment phosphoribosylglycinamide formyltransferase [Isoptericola variabilis 225]
Sequence
MQTPSGHPVESTTQARLVVLASGGGSNLAALLAAHDDPAYGARVVGVVSDKPEAGALRLA
RDAGVASVVVAPADFEDRAAWNVGMAEAVAVFRPDYVVLAGFMRILAPSFVDRFAGRIVN
THPALLPSFPGAHGVRDALAYGVKVTGCTVHVVDTGVDTGPIIAQAAVPVVDGDDEASLH
ERIKVAERALLVETVGRVAREGLRVDGRRAVVGR
Download sequence
Identical sequences F6FWX8
WP_013837942.1.6766 gi|334336292|ref|YP_004541444.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]