SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334336309|ref|YP_004541461.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334336309|ref|YP_004541461.1|
Domain Number 1 Region: 105-301
Classification Level Classification E-value
Superfamily Formyltransferase 2.22e-55
Family Formyltransferase 0.00035
Further Details:      
 
Domain Number 2 Region: 25-101
Classification Level Classification E-value
Superfamily ACT-like 8.4e-17
Family BT0572-like 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|334336309|ref|YP_004541461.1|
Sequence length 301
Comment formyltetrahydrofolate deformylase [Isoptericola variabilis 225]
Sequence
MGSVTTTEPAVPDDRDAPAQPATEWVLALSCPDRPGIVHAVAGMLAAHDGNITESQQFGD
PASGLFFMRVQVATTAGRAELEAALGPVAAEFGMTWSLDVVGRPMRTLILVSRAAHCLVD
LLYRERYQDMPIDVVGVAGNHRDLQDLAAFYGKPFHHIPVTPDTKAVAESRLRDLVDELD
VELVVLARYMQILSDDLCRDLAGRVINIHHSFLPSFKGARPYAQAHDRGVKLIGATSHYV
TGDLDEGPIIEQDVERVDHSHAVADLVALGEDVERRTLARAVRWHAEHRVLLDGHRTVVF
R
Download sequence
Identical sequences F6FX64
gi|334336309|ref|YP_004541461.1| WP_013837959.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]