SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334337762|ref|YP_004542914.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334337762|ref|YP_004542914.1|
Domain Number 1 Region: 6-296
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.19e-70
Family ATP synthase (F1-ATPase), gamma subunit 0.0000639
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|334337762|ref|YP_004542914.1|
Sequence length 299
Comment ATP synthase subunit gamma [Isoptericola variabilis 225]
Sequence
MAGGSQRVYKQRIKSTQSLKKMFRAQELIAASRIGKARARTAAATPYERAITRAVSAVAT
HSSTNHPLTSERDDTNRVAVLVIGADRGQAGAYSASLVRETEKLVAQLRAEGKEVSLYAT
GRRAIAFYRYRKRELAAEWSYGSENPQVDVATEVADTMLGAFLAPAEEGGVAELHVVYTQ
FVNMVTQRPRVVRMLPLEVVEGVAVPGEHQALPLYDFEPSPEVVLDALLPRYVRSRIFAF
MLDAAASELAARQRAMHTATDNAEDLIRTYTRLANQARQADITQEISEIVSGADALAAS
Download sequence
Identical sequences F6FR70
gi|334337762|ref|YP_004542914.1| WP_013839411.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]