SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|334337840|ref|YP_004542992.1| from Isoptericola variabilis 225

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|334337840|ref|YP_004542992.1|
Domain Number 1 Region: 8-134
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 3.14e-31
Family Phosphoglucomutase, first 3 domains 0.00019
Further Details:      
 
Domain Number 2 Region: 161-269
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 6.67e-28
Family Phosphoglucomutase, first 3 domains 0.00011
Further Details:      
 
Domain Number 3 Region: 288-379
Classification Level Classification E-value
Superfamily Phosphoglucomutase, first 3 domains 1.26e-25
Family Phosphoglucomutase, first 3 domains 0.0012
Further Details:      
 
Domain Number 4 Region: 384-473
Classification Level Classification E-value
Superfamily Phosphoglucomutase, C-terminal domain 6.63e-17
Family Phosphoglucomutase, C-terminal domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|334337840|ref|YP_004542992.1|
Sequence length 478
Comment phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain II [Isoptericola variabilis 225]
Sequence
MTIDLASIIKAYDVRGTVPDQLSPAVAEAIGAAFARVVALPEGATTVVVGRDMRESGPAL
VEAFAAGVTAAGLDVVDVGLCSTDGLYFASGRFEAPGAMFTASHNPAAYNGIKLCRAGAR
PVGQDTGLAEVRALAQEILDGATTPEPATTPGRVTARDVLADYAGFLRDLVDLSGVRPLR
VVVDAGNGMGGHTVPAVLGTAAGLPALPLEVVPLYFELDGSFPNHEANPLEPANLRDLQA
AVVEHGADVGLAFDGDADRCFVVDERGEPVSPSAITALVGLREVAKELAAGRQPTVIHNL
ITSRAVPDLLECAGARTVRTRVGHSFIKARMAEHDAVFGGEHSAHYYFRDFWFADTGMLA
AMHVLAALGSQPHPLSALAEMYSPYVASGEINSTVADAAAATARVRQAYASAYPGAEVDE
LDGLTVAHWDAHPQWWFNLRASNTEPLLRLNVEAADEDIMIKVRDDVLSLVREEGRTA
Download sequence
Identical sequences F6FS01
gi|334337840|ref|YP_004542992.1| WP_013839489.1.6766

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]