SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311277830|ref|YP_003940061.1| from Enterobacter cloacae SCF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311277830|ref|YP_003940061.1|
Domain Number 1 Region: 13-325
Classification Level Classification E-value
Superfamily SIS domain 2.22e-66
Family mono-SIS domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|311277830|ref|YP_003940061.1|
Sequence length 328
Comment KpsF/GutQ family protein [Enterobacter lignolyticus SCF1]
Sequence
MSQIDLQPDFDFQKAGLEVLEIEREGLAQLDQYINQDFALACERMFKCGGKVVVMGMGKS
GHIGRKMAATFASTGTSSFFVHPGEAAHGDLGMVTAQDVVIALSNSGESNEILALIPVLK
RLQVPLICMTGRADSSMAKAADIHLCVKVQKEACPLGLAPTSSTTAALVMGDALAVALLK
ARGFTAEDFALSHPGGALGRKLLLRVNDIMHTGDEIPRVNKAASLRDALLEITRKNLGMT
VICDDQMTIDGIFTDGDLRRVFDMGADVRSLSIADVMTHGGIRVRSGTLAVDVLNLMQSR
HITCVMVADGDHLLGVVHMHDLLRAGVV
Download sequence
Identical sequences E3G0V3
WP_013364531.1.3647 gi|311277830|ref|YP_003940061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]