SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311277879|ref|YP_003940110.1| from Enterobacter cloacae SCF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311277879|ref|YP_003940110.1|
Domain Number 1 Region: 1-191
Classification Level Classification E-value
Superfamily SIS domain 1.07e-52
Family mono-SIS domain 0.00000186
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311277879|ref|YP_003940110.1|
Sequence length 196
Comment sugar isomerase (SIS) [Enterobacter lignolyticus SCF1]
Sequence
MLDRIKACFTESIQTQIAAAEALPDAISRAAMTLVQSLLNGNKILCCGNGTSAANAQHFA
ACMINRFETERPGLPAIALNTDNVVLTAIANDRLHDEVYAKQVRALGHAGDVLLAISTRG
NSRDIVKAVEAAVTRDMTIVALTGYDGGELAGLLGQQDVEIRIPSHRSARIQEMHMLTVN
CLCDLIDNTLFPHQDD
Download sequence
Identical sequences E3G102
WP_013364579.1.3647 WP_013364579.1.61248 gi|311277879|ref|YP_003940110.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]