SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311279007|ref|YP_003941238.1| from Enterobacter cloacae SCF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311279007|ref|YP_003941238.1|
Domain Number 1 Region: 14-251
Classification Level Classification E-value
Superfamily SIS domain 1.89e-47
Family mono-SIS domain 0.0000124
Further Details:      
 
Weak hits

Sequence:  gi|311279007|ref|YP_003941238.1|
Domain Number - Region: 240-274
Classification Level Classification E-value
Superfamily UBA-like 0.0531
Family UBA domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311279007|ref|YP_003941238.1|
Sequence length 310
Comment hypothetical protein Entcl_1694 [Enterobacter lignolyticus SCF1]
Sequence
MEVCMSSKATGSMMERRNTCTENIDKLSTEDMLATILQDDRAIADAIAVCLPDITRLVDN
AIATLSRGGRLVIVGAGASGRAAMQAACEYAPEAHHAVIGLIAGGADALLQAREAAASDY
ERGINDLQTLDFNSNDMLLGLSVSGKTPWVWGALRYAGSLGATVATITQNAASEVAQLAD
IVIAPQTGPEVVVGFANPKARLAQRQILNMLSTALAVRTGRVYSNLRVDINAADTHWAER
QIAIVMEAAQCPRAEAKRALESCNHSCRTAILMLLTGLDAWHARDLLADNNEHLRMALQE
AKGRTAMTTH
Download sequence
Identical sequences E3G140
gi|311279007|ref|YP_003941238.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]