SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311279286|ref|YP_003941517.1| from Enterobacter cloacae SCF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311279286|ref|YP_003941517.1|
Domain Number 1 Region: 288-422
Classification Level Classification E-value
Superfamily CBS-domain pair 6.44e-21
Family CBS-domain pair 0.0078
Further Details:      
 
Domain Number 2 Region: 432-517
Classification Level Classification E-value
Superfamily FAD-binding/transporter-associated domain-like 1.34e-17
Family CorC/HlyC domain-like 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|311279286|ref|YP_003941517.1|
Domain Number - Region: 7-223
Classification Level Classification E-value
Superfamily MFS general substrate transporter 0.00131
Family LacY-like proton/sugar symporter 0.067
Further Details:      
 
Domain Number - Region: 246-269
Classification Level Classification E-value
Superfamily Head-to-tail joining protein W, gpW 0.0706
Family Head-to-tail joining protein W, gpW 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311279286|ref|YP_003941517.1|
Sequence length 519
Comment integral membrane protein TerC [Enterobacter lignolyticus SCF1]
Sequence
MEFLMDPSIWAGLLTLVVLEIVLGIDNLVFIAILADKLPPKQRDKARLMGLSLALVMRLV
LLSVISWLVTLTSPLFTVWDYSFSGRDLIMLLGGLFLLFKATTELHERLENRQHDSGHGK
GYASFWVVVLQIVVLDAVFSLDAVITAVGMVNHLPVMMTAVVIAMAVMLLASKPLTRFVN
QHPTVVVLCLSFLLMIGLSLIAEGFGFHIPKGYLYAAIGFSIIIELFNQIARRNFIRHQS
ALPLRARTADAILRLMGGRKQVSVQHDGESPATVPVPEGAFADEERYMINGVLTLASRSL
RTIMTPRGEISWVDASLGVDEIREQLLSSPHSLFPVCRGELDEIIGIVRAKEMLVALEAG
EDVAAIAAGSPAIIVPETLDPINLLGVLRRARGSFVIVTNEFGVVQGLVTPLDVLEAIAG
EFPDADETPEIVIDGDGWLVKGTTDLHALQQALGLDGLVNDDDDIATVAGLVIAVNGQIP
RAGDVFTVGTLQITVMEANDYRVDMVRIVKERPHDEEQD
Download sequence
Identical sequences E3G4C0
WP_013365973.1.3647 WP_013365973.1.61248 gi|311279286|ref|YP_003941517.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]