SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|311280765|ref|YP_003942996.1| from Enterobacter cloacae SCF1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|311280765|ref|YP_003942996.1|
Domain Number 1 Region: 10-185
Classification Level Classification E-value
Superfamily SIS domain 2.43e-28
Family mono-SIS domain 0.0000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|311280765|ref|YP_003942996.1|
Sequence length 186
Comment 6-phospho 3-hexuloisomerase [Enterobacter lignolyticus SCF1]
Sequence
MSVKQNTLNILSELQRNALNIDDVQAGHFIESIKNARHIFLQGAGRSGIAIRGFANRLLH
LGFSVSIVGDVSSPHTKPGDLVIIGSGSGETGSLVSLAQKAAACGVDVALVTLKAESTIG
KLAKSVLVLPGTVKEDNDRQEGAFSQPMGSAFEQLCFITYDAIVLELMAQIGETSDSMFK
RHADLE
Download sequence
Identical sequences E3G7L2
gi|311280765|ref|YP_003942996.1| WP_013367438.1.3647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]