SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479182117|ref|YP_007809230.1| from butyrate-producing bacterium SM4/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479182117|ref|YP_007809230.1|
Domain Number 1 Region: 25-262
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 7.06e-52
Family PP-loop ATPase 0.00011
Further Details:      
 
Domain Number 2 Region: 387-474
Classification Level Classification E-value
Superfamily PheT/TilS domain 1.7e-21
Family tRNA-Ile-lysidine synthetase, TilS, C-terminal domain 0.012
Further Details:      
 
Domain Number 3 Region: 243-353
Classification Level Classification E-value
Superfamily MesJ substrate recognition domain-like 0.00000366
Family MesJ substrate recognition domain-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479182117|ref|YP_007809230.1|
Sequence length 482
Comment tRNA(Ile)-lysidine synthetase, N-terminal domain/tRNA(Ile)-lysidine synthetase, C-terminal domain [butyrate-producing bacterium SM4/1]
Sequence
MRRNERGDGTKEERGRDRMREKVSRYMEKNGMLKAGQRVVVGLSGGADSVCLLSLLSDMR
SSLSIRLRAVHVHHGLRGQEADRDADFSRELCRKLDIPFILKMENAHQEAQNRRISEEEA
GRLLRYEAFEQEAARWEEEEREQEGAALPVRIAVAHHGDDSAETILYHLFRGSGLRGLAG
IAPVRGRVIRPLLCVSRQEILEYLREEGLSYVTDSTNLLNDYTRNRLRNQILPMAVQEIN
RGAVEHILRAGEIIGEADQFFRERAGKFLKKEGIWKESCLEKSRMLAVPVSALGSLAHIE
QGYVIREAFSELGWPLRNIDASHIESILSLLDGRTGAGADLPGGVRAERVYENLVLKKKE
RAAAKDGLPRLSMEVIPRENQAEIPKNRYTKWFDYDKIKDTLSVRYRLPGDYITLKGGGR
KSLKSLFIDEKIPREMRGSIPLLAEGNHVLWMIGGRISEYYKVTEQTKRILKVHLDGGTN
CG
Download sequence
Identical sequences A0A1Y4NP92 D4MP94
gi|479182117|ref|YP_007809230.1| WP_015544060.1.9575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]