SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479182505|ref|YP_007809618.1| from butyrate-producing bacterium SM4/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479182505|ref|YP_007809618.1|
Domain Number 1 Region: 217-414
Classification Level Classification E-value
Superfamily PheT/TilS domain 6.54e-70
Family B3/B4 domain of PheRS, PheT 0.000009
Further Details:      
 
Domain Number 2 Region: 38-209
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.94e-41
Family Myf domain 0.0072
Further Details:      
 
Domain Number 3 Region: 481-706
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.52e-38
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00097
Further Details:      
 
Domain Number 4 Region: 717-801
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 3.53e-24
Family Anticodon-binding domain of PheRS 0.00062
Further Details:      
 
Domain Number 5 Region: 422-489
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.000000000000011
Family Domains B1 and B5 of PheRS-beta, PheT 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|479182505|ref|YP_007809618.1|
Sequence length 802
Comment phenylalanyl-tRNA synthetase beta subunit [butyrate-producing bacterium SM4/1]
Sequence
MNTALSWIKAYVPDLDVTAQEYTDAMTLTGTKVEGYECLDKNLDKIVVGQITEIERHPDA
DKLVVCQVDLGGTSTQIVTGAPNVKVGQKVPVVLDGGRVAGDHDGGRPEGGIRIKKGKLR
GVESNGMMCSIEELGSSREMYPEAPEQGIYIFPEDTEVGSDAIEALGLRDVVFEYEITSN
RVDCYSVIGIAREAAATFGKTFCEPEIKKTGNGEDIHDFLKVSVENTELCPRYCARMVKN
IKLGPSPDWMRRRLAASGIRPINNIVDITNYVMEEYGQPMHAYDYDQIAGQQIVVKCAQD
GEVFETLDGQERKLDSQILMINDGEKAVGIAGIMGGENSKITDNVKTMVFEAACFDGTNI
RLSAKRVGLRTDASGKFEKGLDPNTAELAINRACQLIEELGAGEVVGGMIDVYPVKREGN
RVPFEPEKINRLLGTNIDRADMISYLKSVELEYDAATEEIVVPSWRQDVHRMADVAEEVA
RFYGYDVIPTALPTGEATAGKLSFKLRVEEVARRIAEFCGFSQSMTYSFESPKVFDRLLI
PEDSTLRRVVTISNPLGEDFSIMRTTPLNGMLTSLSTNYNRRNKDVKLYELATIYLPAED
SVSKEYLEQTGLPMLPDERQQFTLGMYGEGDFFTMKGVVEEFLEKIGLNKKPRYNPEAGK
SFLHPGRQAEISYGDTVIGYMGEIHPDVADNYKIGEKAYVAVLDMPNLIPLATFDHKYEG
IAKYPSVTRDISMVMKKEVLAGQIEEIIEQRGGKILESYKLFDVYEGSQITAGYKSVAYS
ITFRSKDHTLEEKEVASAMQKF
Download sequence
Identical sequences D4MQD2
gi|479182505|ref|YP_007809618.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]