SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|479182649|ref|YP_007809762.1| from butyrate-producing bacterium SM4/1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|479182649|ref|YP_007809762.1|
Domain Number 1 Region: 84-178
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.18e-34
Family Ribosomal protein L6 0.0000349
Further Details:      
 
Domain Number 2 Region: 1-83
Classification Level Classification E-value
Superfamily Ribosomal protein L6 1.01e-26
Family Ribosomal protein L6 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|479182649|ref|YP_007809762.1|
Sequence length 180
Comment LSU ribosomal protein L6P [butyrate-producing bacterium SM4/1]
Sequence
MSRIGRMPVAIPAGVTVTIAENNVVTVKGPKGTLERALPVEMSIKEEDGQIVVTRPNDLK
KMKSLHGLTRTLINNMIHGVTEGYEKVLEINGVGYRAAKQGKKLTLSLGYSHPVEMEDPE
GIETVLDGQNKIIVKGISKEKVGQYAAEIRDKRRPEPYKGKGIKYADEVIRRKVGKTGKK
Download sequence
Identical sequences A0A1Y4NRW4 D4MQS6 D6DLU2 R5MJH8
gi|479182649|ref|YP_007809762.1| gi|479339446|ref|YP_007850664.1| WP_015544466.1.84603 WP_015544466.1.9575

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]