SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307151682|ref|YP_003887066.1| from Cyanothece sp. PCC 7822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307151682|ref|YP_003887066.1|
Domain Number 1 Region: 116-211
Classification Level Classification E-value
Superfamily Coiled-coil domain of nucleotide exchange factor GrpE 2.35e-22
Family Coiled-coil domain of nucleotide exchange factor GrpE 0.0031
Further Details:      
 
Domain Number 2 Region: 213-268
Classification Level Classification E-value
Superfamily Head domain of nucleotide exchange factor GrpE 1.7e-16
Family Head domain of nucleotide exchange factor GrpE 0.0031
Further Details:      
 
Weak hits

Sequence:  gi|307151682|ref|YP_003887066.1|
Domain Number - Region: 9-159
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.00141
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307151682|ref|YP_003887066.1|
Sequence length 287
Comment GrpE protein HSP-70 cofactor [Cyanothece sp. PCC 7822]
Sequence
MSEDNKQLEEHLDNQVQNSQKPESLIEENANHRNSYSNQPFNDSVSSTTKETATTAEQIP
GDSQLNETSLQIGEIVAALATLLQGNQRGSELLSQLQQIIGSLVEHHQMLLQANESFSEQ
LEEQNQQLETTKRRYVGLAAEFDNFRKRTQREKEDLEKQVKRKTLNELLEVVDNFERARV
QIKPTNDGEMEIHKSYQGVYNNLVKGLKRLGVSAMRPEGEPFDPMYHEAIYREPTNEYPE
GTVIEQLVRGYLLDDQILRHAMVKVAAPPEPESDQSEPTPEAISDAQ
Download sequence
Identical sequences E0U9J0
WP_013321898.1.91546 gi|307151682|ref|YP_003887066.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]