SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307152031|ref|YP_003887415.1| from Cyanothece sp. PCC 7822

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307152031|ref|YP_003887415.1|
Domain Number 1 Region: 42-277
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 2.06e-54
Family Spore coat polysaccharide biosynthesis protein SpsA 0.0035
Further Details:      
 
Domain Number 2 Region: 297-375
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0000000837
Family FCH domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307152031|ref|YP_003887415.1|
Sequence length 395
Comment family 2 glycosyl transferase [Cyanothece sp. PCC 7822]
Sequence
MIDFSAGIVSSGQVRDITPNAILPSVLDTPDHREDMNKNPFPLVSILIPTYQGEKFLGET
LSSALSQTYPHLEIILSDDSSTDQTLQIARIYQEQSPHHFKIFTNPDQGMINNWNYCISQ
AQGDYIKFLFQDDILKPNCLEEMVKLCQKNEKIGMVFCQRELILSKEAETLQSCLNIYNN
CQNLHEHWSILEEIQSGETLLKDPNFLQEPMNKIGEPSNVLIKKEVFDQLGTFDADLCQV
VDVEMWARVMLYYQIGFIDQTLSYFRIHPEQESVKNLETGESIRDHLRFYKKLLTSSYYN
LLPESLKMNIYEKLENYRNDLEKQRDRGIARIQQLEAHEADLESELRKTQSDFFRVQKEL
EKCQATLQQIKSSLFGKMLFAGLKLKRIVQESTEK
Download sequence
Identical sequences E0UDE9
gi|307152031|ref|YP_003887415.1| WP_013322245.1.91546

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]