SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333896978|ref|YP_004470852.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333896978|ref|YP_004470852.1|
Domain Number 1 Region: 1-106
Classification Level Classification E-value
Superfamily YheA/YmcA-like 1.02e-31
Family YheA-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333896978|ref|YP_004470852.1|
Sequence length 109
Comment hypothetical protein Thexy_1147 [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MNVYDKAYELKRAIEELPEYKAFKDAFKKIESNEQNRKMLEDFRKKQLEIQTKELTGKEI
TKEDEEMLKKLYDILSLNPELNGYLAAEYSFSRIMDDITKIIMDVVNLK
Download sequence
Identical sequences F6BKZ6
WP_013787922.1.39170 gi|333896978|ref|YP_004470852.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]