SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333898006|ref|YP_004471880.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333898006|ref|YP_004471880.1|
Domain Number 1 Region: 1-66
Classification Level Classification E-value
Superfamily L28p-like 6.28e-26
Family Ribosomal protein L31p 0.00061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333898006|ref|YP_004471880.1|
Sequence length 69
Comment 50S ribosomal protein L31 [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MKEGIHPTYYHDAVVRCACGNTFVTGSTKKELRVEICSKCHPLFTGQQKLIDTGGRVERF
KKKYNLDTK
Download sequence
Identical sequences F6BL75
gi|333898006|ref|YP_004471880.1| WP_013788935.1.39170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]