SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333896566|ref|YP_004470440.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333896566|ref|YP_004470440.1|
Domain Number 1 Region: 45-281
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.18e-93
Family Phosphate binding protein-like 0.00000432
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333896566|ref|YP_004470440.1|
Sequence length 281
Comment lipoprotein [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MKKSFLFLTLILTFAFILSGCTKSNNVSTTSNANSNTDSSTKMTKIVVGATPNPHAEILN
VVKPILAKEGVDLEIKEFTDYVTPNTALVDKQIDANFFQHVPYLEDFEKKNNVKLVPLVK
VHVEPMGAYSKKIKSKDELKDGATVAVPNDATNEGRALLLLQKEGLIKLKDPNGLTQTPR
DIVDNPKHLKIVELEAPQLPRTLQDVDLAIINTNFALEANLNPLKDAIFMEDKNSPYANV
LVVRQDNQNDPAIQKLAKALNSDEVKKFIEDKYKGAIVPAF
Download sequence
Identical sequences F6BIM4
WP_013787516.1.39170 gi|333896566|ref|YP_004470440.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]