SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333897602|ref|YP_004471476.1| from Thermoanaerobacterium xylanolyticum LX-11

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333897602|ref|YP_004471476.1|
Domain Number 1 Region: 79-209
Classification Level Classification E-value
Superfamily OmpA-like 4.84e-20
Family OmpA-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333897602|ref|YP_004471476.1|
Sequence length 230
Comment OmpA/MotB domain-containing protein [Thermoanaerobacterium xylanolyticum LX-11]
Sequence
MKDEDNVHDYWQSYSDLMAALLLMFALLIVIMIYKYASIAVELNAQKAKVDEIIGVRARI
INQLLNEFKNSDLSLSIDPQTGAISFSEGIFFDKDKFELKDEGKRYLNEFFPRYISILMD
PKFKKYISQIIVEGHTDDTGDYVYNLELSQKRAFEVVRYILQSDIKGIDSKVKSDLMPYI
TANGRSYSQLIIENGKVNREKSRRVEFKFRLKEEEMILEMQKVLGKGSTK
Download sequence
Identical sequences F6BIK5
WP_013788538.1.39170 gi|333897602|ref|YP_004471476.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]