SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387892059|ref|YP_006322356.1| from Pseudomonas fluorescens A506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387892059|ref|YP_006322356.1|
Domain Number 1 Region: 6-278
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.52e-95
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.000000366
Further Details:      
 
Domain Number 2 Region: 281-396
Classification Level Classification E-value
Superfamily a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 2.18e-34
Family a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000566
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387892059|ref|YP_006322356.1|
Sequence length 403
Comment ubiquinol-cytochrome c reductase, cytochrome b [Pseudomonas fluorescens A506]
Sequence
MSKFMDWVDARFPATKMWEDHLSKYYAPKNFNFFYFFGSLALLVLVNQIVTGVWLTMSYT
PSAEEAFASVEYIMRDVEYGSILRLLHSTGASAFFIVVYLHMFRGLLYGSYQKPRELVWV
FGMLIYLALMAEAFMGYLLPWGQMSYWGAQVIISLFGAIPVIGNDLTQWIRGDYLISGIT
LNRFFALHVVALPIVILGLVVLHILALHEVGSNNPDGVDIKKHKDENGIPLDGIPFHPYY
TVKDIVGVVVFLFVFCSIVFFFPEMGGYFLEKPNFEQANAFKTPEHIAPVWYFTPFYAIL
RAIPDKLMGVIAMGAAIAVLFVLPWLDRSPVKSMRYKGWLSKIWLWVFCISFVILGVLGV
LAPTPERTLLSQVCTFLYFAYFILMPFYTRLEKTKPVPERVTG
Download sequence
Identical sequences A0A075PAZ0 A0A0A1Z4S3 A0A0Q8D966 A0A0Q8YGQ9 A0A0R2Y3D0 A0A0R2Z9N8 A0A0R2ZTF0 A0A0R3AMA8 A0A0R3C062 A0A0W0NCX0 A0A127HWN3 A0A176VAH8 A0A1B5DPT9 A0A1E4WBS2 A0A1G3FA89 A0A1H1XNF2 A0A1H5KYF9 A0A1S1V2Q2 A0A1T1IVP0 A0A219A801 A0A292D0C2 I4K260 I4KT71 W2DH12 W2DV70
gi|387892059|ref|YP_006322356.1| WP_003188526.1.100003 WP_003188526.1.10779 WP_003188526.1.12410 WP_003188526.1.13214 WP_003188526.1.13928 WP_003188526.1.1594 WP_003188526.1.2370 WP_003188526.1.24299 WP_003188526.1.24305 WP_003188526.1.24311 WP_003188526.1.27009 WP_003188526.1.28219 WP_003188526.1.29680 WP_003188526.1.30624 WP_003188526.1.31153 WP_003188526.1.32412 WP_003188526.1.33691 WP_003188526.1.33834 WP_003188526.1.3483 WP_003188526.1.35520 WP_003188526.1.3564 WP_003188526.1.37686 WP_003188526.1.40252 WP_003188526.1.41736 WP_003188526.1.41795 WP_003188526.1.42628 WP_003188526.1.45974 WP_003188526.1.46713 WP_003188526.1.49272 WP_003188526.1.50491 WP_003188526.1.5074 WP_003188526.1.52234 WP_003188526.1.52587 WP_003188526.1.53657 WP_003188526.1.54408 WP_003188526.1.5466 WP_003188526.1.55829 WP_003188526.1.56081 WP_003188526.1.56198 WP_003188526.1.63201 WP_003188526.1.63407 WP_003188526.1.65725 WP_003188526.1.66605 WP_003188526.1.69582 WP_003188526.1.69732 WP_003188526.1.71454 WP_003188526.1.76300 WP_003188526.1.7705 WP_003188526.1.77673 WP_003188526.1.84868 WP_003188526.1.85096 WP_003188526.1.86221 WP_003188526.1.87624 WP_003188526.1.87770 WP_003188526.1.88435 WP_003188526.1.88896 WP_003188526.1.89324 WP_003188526.1.89787 WP_003188526.1.90907 WP_003188526.1.93164 WP_003188526.1.94976 WP_003188526.1.95948 WP_003188526.1.96428 WP_003188526.1.96441 WP_003188526.1.96784 WP_003188526.1.98872 WP_003188526.1.99590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]