SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387894454|ref|YP_006324751.1| from Pseudomonas fluorescens A506

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387894454|ref|YP_006324751.1|
Domain Number 1 Region: 5-182
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 1.02e-31
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387894454|ref|YP_006324751.1|
Sequence length 184
Comment cytochrome b561 [Pseudomonas fluorescens A506]
Sequence
MPWKNSDTRYSTMSIALHWLMVVLLAVVYACIELRGQFPKGSGARTLIVEMHFMLGLTVF
VLVWLRLFARSLGVAPKIVPAPPQWQNLLAKLMHWALYALMIGLPIAGWLIVSAKGHSVM
FYGMELPPLIAENKALAEEIEGWHVLFAQVGYWLIGLHALAGIFHHYVVRDNTALRMMPG
GRRL
Download sequence
Identical sequences A0A0W0N7J2 A0A1G3F1E0 A0A1H1S1G2 A0A1Q5WYA6
gi|387894454|ref|YP_006324751.1| WP_014718978.1.100003 WP_014718978.1.24311 WP_014718978.1.28219 WP_014718978.1.35520 WP_014718978.1.40252 WP_014718978.1.46713 WP_014718978.1.50491 WP_014718978.1.93164 WP_014718978.1.95948

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]