SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333982016|ref|YP_004511226.1| from Methylomonas methanica MC09

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333982016|ref|YP_004511226.1|
Domain Number 1 Region: 120-272
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 1.18e-47
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00021
Further Details:      
 
Domain Number 2 Region: 406-547
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 3.66e-37
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00093
Further Details:      
 
Domain Number 3 Region: 1-125
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.96e-28
Family Duplicated SiR/NiR-like domains 1 and 3 0.032
Further Details:      
 
Domain Number 4 Region: 252-276,314-420
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.14e-24
Family Duplicated SiR/NiR-like domains 1 and 3 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333982016|ref|YP_004511226.1|
Sequence length 550
Comment nitrite and sulfite reductase 4Fe-4S region [Methylomonas methanica MC09]
Sequence
MYQYNEQDQTLIEERVTQFRGQTQRFLNGELGPDEFRALRLMNGLYVQTHAPMLRVAVPY
GLLASRQLRMLAKVARDYDKGYCHFTTRQNVQYNWPDLERVPDLLAELATVQMHAIQTSG
NCLRNTTSDHLAGVCPDELEDPRPYCEIIRQWTTLHPEFAYLPRKFKIAVSGSEQDRAAV
QLHDIGVYLVRNEEGRIGFRVLAGGGLGRTPIIGQTVKAFLEKKHLLSYLEAILRVYNLL
GRRDNKYKARIKILVKETGLEKFTALVENEWLSIRDDMLLSDERIAAMQAQFALPAYDPA
ANNDSSLAQHLADDQAFAKWYKYNSTDHRVPGYRAVFVSLKAPDSPPGDITADQLDALAN
LADAYSFGEVRSTHRQNLVLADIKHADLYTLWQKLDALKLATPNIGTATDMICCPGLDFC
SLANAGSIGVAREINEALDDMDYIHDIGDLKINMSGCMNGCAHQSVGHIGILGVDKKGEE
WYQITLGGSSENEAAIGDRLGPSVAKHQITKSITRILDVYIQHRLEEEAFLQTVKRVGLE
PFREKVYANH
Download sequence
Identical sequences F9ZZR7
gi|333982016|ref|YP_004511226.1| WP_013816999.1.77941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]