SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333985761|ref|YP_004514971.1| from Methylomonas methanica MC09

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333985761|ref|YP_004514971.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.1e-126
Family UbiD middle domain-like 0.000000000246
Further Details:      
 
Domain Number 2 Region: 323-485
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 4.97e-66
Family UbiD C-terminal domain-like 0.0000000763
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|333985761|ref|YP_004514971.1|
Sequence length 487
Comment 3-octaprenyl-4-hydroxybenzoate carboxy-lyase [Methylomonas methanica MC09]
Sequence
MKYKDLRDFIQQLEKQGELKRIRAEVDPYLEMTVICDRVLKQGGPALLFENPKGSNIAVL
GNLFGTPKRVAMGMGAKDVSELRGIGELLAYLKEPDPPKGFKDAMDKLPAFKQVLNMAPK
LVGSPPCQEVIRVGDEVDLSVYPIQTCWPEDAAPLITWPLVITKGPNKDRQNLGIYRQQV
IGKNKLIMRWLAHRGGALDFKEWQEKYPGKPFPVAVALGADPATILAAVTPVPDALSEYA
FAGLLRGSKTEVAKCLSNDLQVPASAEIVLEGFIYPGETAPEGPYGDHTGYYNEVDEFPV
FTVERITQRQVPIYHSTYTGRPPDEPAILGVALNEVFVPILQKQFPEIVDFYLPPEGCSY
RMAVISMKKQYAGHAKRVMLGTWSYLRQFMYTKFVIVVDEDVDVRNWQDVIWAITTRMDP
ARDLTILENTPIDYLDFASPVSGLGSKVGFDATNKWPGETNREWGRPIVMRDDVLKKVDA
MWDTLFN
Download sequence
Identical sequences G0A152
WP_013820688.1.77941 gi|333985761|ref|YP_004514971.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]