SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|333985972|ref|YP_004515182.1| from Methylomonas methanica MC09

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333985972|ref|YP_004515182.1|
Domain Number 1 Region: 90-371
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.59e-66
Family RecA protein-like (ATPase-domain) 0.0000000138
Further Details:      
 
Domain Number 2 Region: 48-125
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9e-30
Family Cold shock DNA-binding domain-like 0.0000225
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.00000000000549
Family Rho termination factor, N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|333985972|ref|YP_004515182.1|
Sequence length 418
Comment transcription termination factor Rho [Methylomonas methanica MC09]
Sequence
MNLTELKLKQVSEIIAIAESLGLENIDRARKQELIFSILKKQAKSGEDIFGDGVLEILQD
GFGFLRTPGCSYLAGPDDIYVSPSQIRRFGLRTGDTVSGKIRPPKEGERYFAMLKVESIN
FESPEHAKNKISFSNLTPLFANKRFRLEQGNGTSEDLTARIIDLVAPIGKGQRGLIVSPP
KAGKTMIMQSIAHAIAEKNPECYLIVLLIDERPEEVTEMERCVRGEVVSSTFDEPASRHV
QVADMVIEKARRMVEHKHDVVILLDSITRLARAYNMVVPSSGKLLSGGVDANALEKPKRF
FGAARNIEEGGSLTIIATALVETGSRMDEVIFEEFKGTGNMELHLERKIAEKRIYPAINI
NRSGTRREEYLVDPDELQKTWILRKILQPMDELAASEFLLGKLKDFKTNAEFFDSMKR
Download sequence
Identical sequences G0A324
gi|333985972|ref|YP_004515182.1| WP_013820897.1.77941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]