SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378950556|ref|YP_005208044.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|378950556|ref|YP_005208044.1|
Domain Number - Region: 61-104
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit XI, PsaL 0.0327
Family Photosystem I reaction center subunit XI, PsaL 0.011
Further Details:      
 
Domain Number - Region: 151-223
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0691
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|378950556|ref|YP_005208044.1|
Sequence length 259
Comment hypothetical protein PSF113_2642 [Pseudomonas fluorescens F113]
Sequence
MPFELSVDFATLAILAVVAFIAGFIDAIAGGGGLLTTPALLTAGLPPHLVLGTNKLSSTF
GSATASFTFYKRKLFHPRQWTHALVGTLIGALTGAIVAHYLPAEWLNKMLPVIVFACGLY
LLFGGTPKAPLDSNAPIKKTWQSPQGFSLGFYDGVAGPGTGAFWTVSSLLLYPIDLVKAS
GVARSMNFVSNIAALSVFIFSGQVDWVIGLSMGVSVMIGAFFGARTAISGGAKFIRPVFI
TVVLGLTVRLAWQHWFSVT
Download sequence
Identical sequences G8PYL1
gi|378950556|ref|YP_005208044.1| WP_014338114.1.39650

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]