SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|378951798|ref|YP_005209286.1| from Pseudomonas fluorescens F113

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|378951798|ref|YP_005209286.1|
Domain Number 1 Region: 3-177
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 2.51e-32
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|378951798|ref|YP_005209286.1|
Sequence length 178
Comment cytochrome B561 [Pseudomonas fluorescens F113]
Sequence
MSAPRHFAPLARLLHWLMAVMIIAMLFIGAGMVASVSERHEWLLQLHKPLGIAILLLVIV
RLVVRFTTRQPPLPVDLPAWQVLAANASHVLLYALMLVLPLLGWGMISAAGDPVMLGDSL
QLPSILPAHAQTFALLRKAHGYLAYLLFVTVLVHLAAALFHAWVRRDEVLDSMLRGKA
Download sequence
Identical sequences G8PXT2
WP_014339281.1.39650 gi|378951798|ref|YP_005209286.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]